Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVEOY6)

DTT Name RTP801 messenger RNA (RTP801 mRNA)
Synonyms RTP801 (mRNA); REDD1 (mRNA); REDD-1 (mRNA); Protein regulated in development and DNA damage response 1 (mRNA); HIF-1 responsive protein RTP801 (mRNA); DNA damage-inducible transcript 4 protein (mRNA)
Gene Name DDIT4
DTT Type
Clinical trial target
 [1]
BioChemical Class
mRNA target
UniProt ID
DDIT4_HUMAN
TTD ID
T37245
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
Function
Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and the GTPase RHEB. Plays an important role in responses to cellular energy levels and cellular stress, including responses to hypoxia and DNA damage. Regulates p53/TP53-mediated apoptosis in response to DNA damage via its effect on mTORC1 activity. Its role in the response to hypoxia depends on the cell type; it mediates mTORC1 inhibition in fibroblasts and thymocytes, but not in hepatocytes. Required for mTORC1-mediated defense against viral protein synthesis and virus replication. Inhibits neuronal differentiation and neurite outgrowth mediated by NGF via its effect on mTORC1 activity. Required for normal neuron migration during embryonic brain development. Plays a role in neuronal cell death. Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1).
KEGG Pathway
mTOR signaling pathway (hsa04150 )
PI3K-Akt signaling pathway (hsa04151 )
MicroRNAs in cancer (hsa05206 )
Reactome Pathway
TP53 Regulates Metabolic Genes (R-HSA-5628897 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PF-4523655 DM3YIKR Age-related macular degeneration 9B75.0 Phase 2 [1]
------------------------------------------------------------------------------------

References

1 DNA-damage-inducible transcript 4 (DDIT4; RTP801). SciBX 3(20); doi:10.1038/scibx.2010.629. May 20 2010