Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVFJLX)

DTT Name	Peptide tyrosine tyrosine PYY (PYY)
Synonyms	PYY-II
Gene Name	PYY
DTT Type	Clinical trial target	[1]
BioChemical Class	NPY family
UniProt ID	PYY_HUMAN
TTD ID	T24127
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Function	This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Peptide YY 3-36	DMNU48O	Obesity	5B81	Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of Emisphere.