Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVH9W8)

• DTT Name: Succinate dehydrogenase (SDHD)
• Synonyms: Succinate-ubiquinone reductase membrane anchor subunit; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate dehydrogenase complex subunit D; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; SDH4; QPs3; CybS; CII-4
• Gene Name: SDHD
• DTT Type: Literature-reported target; [1]
• UniProt ID: DHSD_HUMAN
• TTD ID: T39811
• Sequence:
  MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK
  AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL
  QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
• Function: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
• KEGG Pathway:
  Citrate cycle (TCA cycle) (hsa00020)
  Oxidative phosphorylation (hsa00190)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Thermogenesis (hsa04714)
  Non-alcoholic fatty liver disease (hsa04932)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Amyotrophic lateral sclerosis (hsa05014)
  Huntington disease (hsa05016)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway:
  Citric acid cycle (TCA cycle) (R-HSA-71403)
  Respiratory electron transport (R-HSA-611105)
• BioCyc Pathway: MetaCyc:ENSG00000150781-MON

References

• [1] Succinate dehydrogenase is a direct target of sirtuin 3 deacetylase activity. PLoS One. 2011;6(8):e23295.