Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVMO5W)
DTT Name | Interleukin-25 (IL25) | ||||
---|---|---|---|---|---|
Synonyms | UNQ3120/PRO10272; Interleukin-17E; IL17E; IL-25; IL-17E | ||||
Gene Name | IL25 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Cytokine: interleukin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP
PLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT GSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
||||
Function | Proinflammatory cytokine favoring Th2-type immune responses. Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||