Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVS4C3)
| DTT Name | Retinoid-inducible nuclear factor (CXXC5) | ||||
|---|---|---|---|---|---|
| Synonyms |
TCCCIA00297; Retinoidinducible nuclear factor; RINF; Putative NFkappaBactivating protein 102; Putative NF-kappa-B-activating protein 102; Putative MAPKactivating protein PM08; Putative MAPK-activating protein PM08; HSPC195; CXXCtype zinc finger protein 5; CXXC-type zinc finger protein 5; CF5
|
||||
| Gene Name | CXXC5 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRN
KSGIISEPLNKSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHD LAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHL PLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGL AEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELK KKPSAALEKVMLPTGAAFRWFQ |
||||
| Function |
Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest. Involved in myelopoiesis. Transcription factor. Binds to the oxygen responsive element of COX4I2 and represses its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen). May repress COX4I2 transactivation induced by CHCHD2 and RBPJ. May indirectly participate in activation of the NF-kappa-B and MAPK pathways.
|
||||
| Reactome Pathway | |||||