Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVW4XU)
| DTT Name | MYCBP messenger RNA (MYCBP mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | c-Myc-binding protein (mRNA); Associate of Myc 1 (mRNA); AMY1 (mRNA); AMY-1 (mRNA) | ||||
| Gene Name | MYCBP | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE |
||||
| Function | Stimulates the activation of E box-dependent transcription by MYC. May control the transcriptional activity of MYC. | ||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||