Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVZEHU)
| DTT Name | Regenerating islet-derived protein IV (REG4) | ||||
|---|---|---|---|---|---|
| Synonyms |
Regenerating islet-derived protein 4; Regenerating islet-derived family, member 4; Reg IV; RELP; REGIV; REG-like protein; REG-4; Gastrointestinal secretory protein GISP; Gastrointestinal secretory protein; GISP
|
||||
| Gene Name | REG4 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP |
||||
| Function |
May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment.
|
||||
| KEGG Pathway | |||||