Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTW4LYC)

DTT Name	Pituitary adenylate cyclase-activating 38 (PACAP-38)
Synonyms	Pituitary adenylate cyclase-activating polypeptide; PACAP38; PACAP27; PACAP-38; PACAP-27; PACAP; ADCYAP1
Gene Name	ADCYAP1
DTT Type	Clinical trial target	[1]
BioChemical Class	Glucagon
UniProt ID	PACA_HUMAN
TTD ID	T07045
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
Function	Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development through the RAPGEF2/Rap1/B-Raf/ERK pathway.
KEGG Pathway	Insulin secretion (hsa04911 )
Reactome Pathway	G alpha (s) signalling events (R-HSA-418555 ) Glucagon-type ligand receptors (R-HSA-420092 ) NGF-independant TRKA activation (R-HSA-187024 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PACAP38	DMX9AK6	Nerve injury	ND56.4	Phase 1	[1]
------------------------------------------------------------------------------------

References

1	Pituitary adenylate cyclase-activating polypeptides, PACAP-38 and PACAP-27, regulation of sympathetic neuron catecholamine, and neuropeptide Y expr... Ann N Y Acad Sci. 1996 Dec 26;805:204-16; discussion 217-8.