Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTW7OTG)

• DTT Name: Leukotriene C4 synthase (LTC4S)
• Synonyms: Leukotriene-C(4)Leukotriene C4 synthase synthase; Leukotriene-C(4) synthase; LTC4 synthase
• Gene Name: LTC4S
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Carbon-sulfur lyase
• UniProt ID: LTC4S_HUMAN
• TTD ID: T72881
• EC Number: EC 4.4.1.20
• Sequence:
  MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
  PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
  LAALGLLAHFLPAALRAALLGRLRTLLPWA
• Function: Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4.
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691)
  Synthesis of Lipoxins (LX) (R-HSA-2142700)
  Biosynthesis of maresin conjugates in tissue regeneration (MCTR) (R-HSA-9026762)
  Biosynthesis of protectin and resolvin conjugates in tissue regeneration (PCTR and RCTR) (R-HSA-9026766)
  Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688)
• BioCyc Pathway: MetaCyc:HS08566-MON

Molecular Interaction Atlas (MIA) of This DTT

4 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
US20160326143, 28	DMAE6CK	N. A.	N. A.	Patented	[2]
US20160326143, 3	DML5KXB	N. A.	N. A.	Patented	[2]
US20160326143, 38	DMUDE89	N. A.	N. A.	Patented	[3]
US20160326143, 50	DM2DU7R	N. A.	N. A.	Patented	[3]

References

• [1] Leukotriene C4 synthase: a candidate gene for the aspirin-intolerant asthmatic phenotype. Allergy Asthma Proc. 1999 Nov-Dec;20(6):353-60.
• [2] COMPOUNDS AND USES. US20160326143.
• [3] Compounds and uses. US9657001.