Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWIJYH)

• DTT Name: E2F3 messenger RNA (E2F3 mRNA)
• Synonyms: Transcription factor E2F3 (mRNA); KIAA0075 (mRNA); E2F-3 (mRNA)
• Gene Name: E2F3
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: E2F3_HUMAN
• TTD ID: T28343
• Sequence:
  MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
  LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
  RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
  TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
  WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
  YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
  MKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG
  PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
• Function: The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters. Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication.
• KEGG Pathway:
  Cell cycle (hsa04110)
  Hepatitis B (hsa05161)
  HTLV-I infection (hsa05166)
  Pathways in cancer (hsa05200)
  MicroRNAs in cancer (hsa05206)
  Pancreatic cancer (hsa05212)
  Glioma (hsa05214)
  Prostate cancer (hsa05215)
  Melanoma (hsa05218)
  Bladder cancer (hsa05219)
  Chronic myeloid leukemia (hsa05220)
  Small cell lung cancer (hsa05222)
  Non-small cell lung cancer (hsa05223)
• Reactome Pathway:
  Oxidative Stress Induced Senescence (R-HSA-2559580)
  Oncogene Induced Senescence (R-HSA-2559585)
  CDC6 association with the ORC (R-HSA-68689)
  G2 Phase (R-HSA-68911)
  Cyclin D associated events in G1 (R-HSA-69231)
  Association of licensing factors with the pre-replicative complex (R-HSA-69298)
  Pre-NOTCH Transcription and Translation (R-HSA-1912408)

Molecular Interaction Atlas (MIA) of This DTT

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 114170	DMUVS0E	Discovery agent	N.A.	Investigative	[1]
ISIS 114184	DM60V4N	Discovery agent	N.A.	Investigative	[1]
ISIS 114197	DMVJN4B	Discovery agent	N.A.	Investigative	[1]
ISIS 114232	DM2GH8X	Discovery agent	N.A.	Investigative	[1]

References

• [1] US patent application no. 6,165,791, Antisense inhibition of E2F transcription factor 3 expression.