Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWODQF)

• DTT Name: Fibrin (FG)
• Synonyms: Fibrinogen (31-44)
• Gene Name: FGA
• DTT Type: Successful target; [1]
• UniProt ID: FIBA_HUMAN ; FIBB_HUMAN
• TTD ID: T19414
• Sequence:
  MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
  NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA
  NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC
  RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
  LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
  GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW
  NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
  SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
  EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF
  VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
  YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS
  VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR
  GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH
  NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG
  VVWVSFRGADYSLRAVRMKIRPLVTQ
• Function: A fibrous, non-globular protein involved in the clotting of blood. Formed by the action of the protease thrombin on fibrinogen which causes it to polymerize.

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Baquting	DME1DJX	Bleeding disorder	GA20-GA21	Approved	[2]
Beriplast-P	DMEBY2D	Wound healing	EL8Y	Approved	[3]
Fibrinolysin	DM9Q8SO	Wound healing	EL8Y	Approved	[4]
TachoComb	DM6S0HB	Wound healing	EL8Y	Approved	[1]

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Adhexil	DMFIP35	Injury	NA00-ND5Z	Phase 3	[5]
Alfimeprase	DMVHRL8	Peripheral vascular disease	BD4Z	Phase 3	[6]
KUR-211	DM2N0Z3	Ulcer	CA02-CB40	Phase 2	[7]
KUR-212	DMB4HCY	Wound healing	EL8Y	Phase 2	[8]
Plasmin	DMOB1EM	Occlusive disease	BD4Z	Phase 2	[9]
Recombinant batroxobin	DMURX4B	Blood forming organ disorder	JB64.1	Phase 2	[10]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
EP-2104R	DMG3R14	Cardiovascular disease	BA00-BE2Z	Discontinued in Phase 2	[11]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
FX-107	DM7UJ1I	Dengue fever	1D2Z	Preclinical	[12]

References

• [1] Pancreaticojejunostomy using a fibrin adhesive sealant (TachoComb) for the prevention of pancreatic fistula after pancreaticoduodenectomy. Hepatogastroenterology. 2011 Jan-Feb;58(105):187-91.
• [2] Baquting, enable our sales and marketing team to effectively promote our principal products and help to stimulate the sales of our other pharmaceuticals.
• [3] Wound healing and degradation of the fibrin sealant Beriplast P following partial liver resection in rabbits. Wound Repair Regen. 2005 May-Jun;13(3):318-23.
• [4] FIBRINOLYSIN, FIBRIN AND HYALINE MEMBRANES. Pediatrics. 1963 Nov;32:940-2.
• [5] Evaluation of a fibrin preparation containing tranexamic acid (Adhexil) in a rabbit uterine horn model of adhesions with and without bleeding and in a model with two surgical loci. Fertil Steril. 2010 Mar 1;93(4):1045-51.
• [6] Disulfide structure of alfimeprase: A recombinant analog of fibrolase. Protein Sci. 2001 June; 10(6): 1264-1267.
• [7] Clinical pipeline report, company report or official report of Kuros.
• [8] Clinical pipeline report, company report or official report of Kuros.
• [9] ClinicalTrials.gov (NCT01014975) A Safety and Dose Finding Study of Plasmin (Human) Administered Into the Middle Cerebral Artery of Stroke Patients. U.S. National Institutes of Health.
• [10] Functional characterization of recombinant batroxobin, a snake venom thrombin-like enzyme, expressed from Pichia pastoris. FEBS Lett. 2004 Jul 30;571(1-3):67-73.
• [11] EP-2104R: a fibrin-specific gadolinium-Based MRI contrast agent for detection of thrombus. J Am Chem Soc. 2008 May 7;130(18):6025-39.
• [12] FX-06, a fibrin-derived Bbeta15-42 peptide for the potential treatment of reperfusion injury following myocardial infarction. Curr Opin Investig Drugs. 2009 Sep;10(9):997-1003.