Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWYMFE)

• DTT Name: Mitochondrial 10kDa heat shock protein (HSPE1)
• Synonyms: Hsp10; Earlypregnancy factor; Early-pregnancy factor; EPF; Chaperonin 10; CPN10; 10 kDa heat shock protein, mitochondrial; 10 kDa chaperonin
• Gene Name: HSPE1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Heat shock protein
• UniProt ID: CH10_HUMAN
• TTD ID: T30940
• Sequence:
  MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
  QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
• Function: Together with Hsp60, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein. Co-chaperonin implicated in mitochondrial protein import and macromolecular assembly.
• Reactome Pathway: RHOG GTPase cycle (R-HSA-9013408)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
XToll	DM148HX	Autoimmune diabetes	5A10	Phase 1/2	[1]

References

• [1] XToll, a recombinant chaperonin 10 as an anti-inflammatory immunomodulator. Curr Opin Investig Drugs. 2008 May;9(5):523-33.