Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXAUJ8)

• DTT Name: Influenza M messenger RNA (Influenza M mRNA)
• Synonyms: Proton channel protein M2 (mRNA); Matrix protein 2 (mRNA); M (mRNA)
• Gene Name: Influenza M mRNA
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: M2_I97A1
• TTD ID: T30397
• Sequence:
  MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK
  RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE
• Function: After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation. Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry.

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 3309	DMDSMJU	Discovery agent	N.A.	Investigative	[1]

References

• [1] US patent application no. 5,580,767, Inhibition of influenza viruses by antisense oligonucleotides.