Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXH9AD)

DTT Name	Interleukin 5 receptor alpha (IL5RA)
Synonyms	Interleukin-5 receptor subunit alpha; IL5R; IL-5RA; IL-5R-alpha; IL-5R subunit alpha; IL-5 receptor subunit alpha; CDw125; CD125
Gene Name	IL5RA
DTT Type	Successful target	[1]
BioChemical Class	Cytokine receptor
UniProt ID	IL5RA_HUMAN
TTD ID	T90828
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
Function	The alpha chain binds to IL5. This is the receptor for interleukin-5.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) JAK-STAT signaling pathway (hsa04630 ) Hematopoietic cell lineage (hsa04640 ) Pathways in cancer (hsa05200 )
Reactome Pathway	RAF/MAP kinase cascade (R-HSA-5673001 ) Interleukin receptor SHC signaling (R-HSA-912526 ) Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benralizumab	DM7P1J4	Asthma	CA23	Approved	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CSL311	DMC21G0	Asthma	CA23	Phase 1	[2]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
YM90709	DML5DU0	Discovery agent	N.A.	Investigative	[3]
------------------------------------------------------------------------------------

References

1	Benralizumab--a humanized mAb to IL-5R with enhanced antibody-dependent cell-mediated cytotoxicity--a novel approach for the treatment of asthma. Expert Opin Biol Ther. 2012 Jan;12(1):113-8.
2	Anti-beta(c) mAb CSL311 inhibits human nasal polyp pathophysiology in a humanized mouse xenograft model. Allergy. 2020 Feb;75(2):475-478.
3	Characterization of YM-90709 as a novel antagonist which inhibits the binding of interleukin-5 to interleukin-5 receptor. Int Immunopharmacol. 2002 Nov;2(12):1693-702.