Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTXKA7D)
| DTT Name | Adiponectin (ADIPOQ) | ||||
|---|---|---|---|---|---|
| Synonyms |
Gelatin-binding protein; GBP28; ApM-1; Adipose most abundant gene transcript 1 protein; Adipose most abundant gene transcript 1; Adipocyte, C1q and collagen domain-containing protein; Adipocyte, C1q and collagen domain containingprotein; Adipocyte complement-related 30 kDa protein; APM1; ACRP30; ACDC; 30 kDa adipocyte complement-related protein
|
||||
| Gene Name | ADIPOQ | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Adiponectin protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY HDTN |
||||
| Function |
Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||