Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTXUBN2)

DTT Name Caveolin 1 (CAV1)
Synonyms Caveolin1; Caveolin-1; Cav-1
Gene Name CAV1
DTT Type
Literature-reported target
 [1]
BioChemical Class
Caveolin protein
UniProt ID
CAV1_HUMAN
TTD ID
T93945
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Function
Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation. May act as a scaffolding protein within caveolar membranes.
KEGG Pathway
Endocytosis (hsa04144 )
Focal adhesion (hsa04510 )
Prion disease (hsa05020 )
Bacterial invasion of epithelial cells (hsa05100 )
Proteoglycans in cancer (hsa05205 )
Viral myocarditis (hsa05416 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
eNOS activation (R-HSA-203615 )
NOSTRIN mediated eNOS trafficking (R-HSA-203641 )
Basigin interactions (R-HSA-210991 )
Disassembly of the destruction complex and recruitment of AXIN to the membrane (R-HSA-4641262 )
VEGFR2 mediated vascular permeability (R-HSA-5218920 )
RHOA GTPase cycle (R-HSA-8980692 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
RHOB GTPase cycle (R-HSA-9013026 )
RHOC GTPase cycle (R-HSA-9013106 )
CDC42 GTPase cycle (R-HSA-9013148 )
RAC1 GTPase cycle (R-HSA-9013149 )
RAC2 GTPase cycle (R-HSA-9013404 )
RHOD GTPase cycle (R-HSA-9013405 )
RHOQ GTPase cycle (R-HSA-9013406 )
RHOH GTPase cycle (R-HSA-9013407 )
RHOG GTPase cycle (R-HSA-9013408 )
RHOJ GTPase cycle (R-HSA-9013409 )
RAC3 GTPase cycle (R-HSA-9013423 )
RHOF GTPase cycle (R-HSA-9035034 )
FOXO-mediated transcription of cell cycle genes (R-HSA-9617828 )
RND3 GTPase cycle (R-HSA-9696264 )
RND2 GTPase cycle (R-HSA-9696270 )
RND1 GTPase cycle (R-HSA-9696273 )
SARS-CoV-2 targets host intracellular signalling and regulatory pathways (R-HSA-9755779 )
SARS-CoV-1-host interactions (R-HSA-9767675 )
Triglyceride catabolism (R-HSA-163560 )

References

1 Caveolin-1: An Oxidative Stress-Related Target for Cancer Prevention. Oxid Med Cell Longev. 2017;2017:7454031.