Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTXZAJ5)
| DTT Name | Galanin (GAL) | ||||
|---|---|---|---|---|---|
| Synonyms | Galanin peptides; Galanin messageassociated peptide; GMAP; GAL | ||||
| Gene Name | GAL | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Galanin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGL
TSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI ERS |
||||
| Function | Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||