Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTY0DN9)

• DTT Name: Serum amyloid A-1 protein (SAA1)
• Synonyms: SAA
• Gene Name: SAA1
• DTT Type: Literature-reported target; [1]
• UniProt ID: SAA1_HUMAN
• TTD ID: T55447
• Sequence:
  MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
  DAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE
  KY
• Function: Major acute phase protein.
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  G alpha (i) signalling events (R-HSA-418594)
  Formyl peptide receptors bind formyl peptides and many other ligands (R-HSA-444473)
  TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Advanced glycosylation endproduct receptor signaling (R-HSA-879415)
  TRAF6 mediated NF-kB activation (R-HSA-933542)
  Amyloid fiber formation (R-HSA-977225)
  Scavenging by Class B Receptors (R-HSA-3000471)

References

• [1] Discovery and Validation of a Six-Marker Serum Protein Signature for the Diagnosis of Active Pulmonary Tuberculosis. J Clin Microbiol. 2017 Oct;55(10):3057-3071.