Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTY63XT)

DTT Name	B-type natriuretic peptide (BNP)
Synonyms	Natriuretic peptides B; NPPB; Gammabrain natriuretic peptide; BNP32; BNP(529); BNP(132)
Gene Name	NPPB
DTT Type	Literature-reported target	[1]
BioChemical Class	Natriuretic peptide family
UniProt ID	ANFB_HUMAN
TTD ID	T55302
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI SSSSGLGCKVLRRH
Function	Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
KEGG Pathway	cGMP-PKG signaling pathway (hsa04022 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BD-NP	DMT0S7M	Hypertension	BA00-BA04	Investigative	[1]
------------------------------------------------------------------------------------

References

1	A Novel Designer Natriuretic and Diuretic Peptide Based Upon an Alternatively Spliced BNP Without Vascular Vasodilatory Actions. Circulation, 2006, 114:II_270.