Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTY7FKA)

• DTT Name: Beta-2-microglobulin (B2M)
• Synonyms: Beta-2-microglobulin
• Gene Name: B2M
• DTT Type: Literature-reported target; [1]
• UniProt ID: B2MG_HUMAN
• TTD ID: T58080
• Sequence:
  MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
  KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• Function: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  Human cytomegalovirus infection (hsa05163)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Herpes simplex virus 1 infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Human immunodeficiency virus 1 infection (hsa05170)
• Reactome Pathway:
  Endosomal/Vacuolar pathway (R-HSA-1236977)
  Nef mediated downregulation of MHC class I complex cell surface expression (R-HSA-164940)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)
  DAP12 interactions (R-HSA-2172127)
  DAP12 signaling (R-HSA-2424491)
  Neutrophil degranulation (R-HSA-6798695)
  Interferon gamma signaling (R-HSA-877300)
  Modulation by Mtb of host immune system (R-HSA-9637628)
  SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)
  Amyloid fiber formation (R-HSA-977225)
  Antigen Presentation (R-HSA-983170)
  ER-Phagosome pathway (R-HSA-1236974)

References

• [1] Identification of beta2-microglobulin as a potential target for ovarian cancer. Cancer Biol Ther. 2009 Dec;8(24):2323-8.