Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYAHBP)

• DTT Name: Glutathione peroxidase (GPX1)
• Synonyms: GSHPx-1; GPX1; Cellular glutathione peroxidase
• Gene Name: GPX1
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Peroxidases
• UniProt ID: GPX1_HUMAN
• TTD ID: T70654
• EC Number: EC 1.11.1.9
• Sequence:
  MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
  ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
  GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
  RRFQTIDIEPDIEALLSQGPSCA
• Function: Protects the hemoglobin in erythrocytes from oxidative breakdown.
• KEGG Pathway:
  Glutathione metabolism (hsa00480)
  Arachidonic acid metabolism (hsa00590)
  Metabolic pathways (hsa01100)
  Thyroid hormone synthesis (hsa04918)
  Amyotrophic lateral sclerosis (hsa05014)
  Huntington disease (hsa05016)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
• Reactome Pathway:
  Synthesis of 12-eicosatetraenoic acid derivatives (R-HSA-2142712)
  Synthesis of 15-eicosatetraenoic acid derivatives (R-HSA-2142770)
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)
  Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688)
• BioCyc Pathway: MetaCyc:HS00019-MON

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Cellular glutathione peroxidase (GPX1) DME Info
• Gene Name: GPX1

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Hydrogen peroxide	DM1NG5W	Infectious disease	1A00-CA43.1	Approved	[2]

References

• [1] CSF markers in amyotrophic lateral sclerosis. J Neural Transm (Vienna). 2012 Jul;119(7):747-57.
• [2] Catalase and glutathione peroxidase are equally active in detoxification of hydrogen peroxide in human erythrocytes. Blood. 1989 Jan;73(1):334-9.