Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTYH1ZK)
| DTT Name | Beta-microseminoprotein (MSMB) | ||||
|---|---|---|---|---|---|
| Synonyms | Seminal plasma beta-inhibin; Prostate secretory protein of 94 amino acids; Prostate secreted seminal plasma protein; PSP94; PSP-94; PRSP; PN44; Immunoglobulin-binding factor; IGBF | ||||
| Gene Name | MSMB | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC
TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
||||
| Function |
A member of the immunoglobulin binding factor family. May have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. Inhibits growth of cancer cells in an experimental model of prostate cancer, though this property is cell line specific.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||