Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYQWA0)

DTT Name	Synaptosomal-associated protein 25 (SNAP25)
Synonyms	Synaptosomal-associated 25 kDa protein; Super protein; SUP; SNAP-25; SNAP
Gene Name	SNAP25
DTT Type	Successful target	[1]
BioChemical Class	Synaptosomal vesicle fusion pore
UniProt ID	SNP25_HUMAN
TTD ID	T71023
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR IMEKADSNKTRIDEANQRATKMLGSG
Function	May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells. t-SNARE involved in the molecular regulation of neurotransmitter release.
KEGG Pathway	Synaptic vesicle cycle (hsa04721 ) Insulin secretion (hsa04911 )
Reactome Pathway	Regulation of insulin secretion (R-HSA-422356 ) Norepinephrine Neurotransmitter Release Cycle (R-HSA-181430 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Botulinum Toxin Type A	DMW67MU	Blepharospasm	9A05.Z	Approved	[1]
------------------------------------------------------------------------------------

References

1	Evaluation of the therapeutic usefulness of botulinum neurotoxin B, C1, E, and F compared with the long lasting type A. Basis for distinct duration... J Biol Chem. 2003 Jan 10;278(2):1363-71.