Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTZEIBV)
| DTT Name | Leukocyte antigen MIC3 (CD9) | ||||
|---|---|---|---|---|---|
| Synonyms |
p24; Tspan29; Tspan-29; Tetraspanin29; Tetraspanin-29; Motilityrelated protein; Motility-related protein; MRP-1; MIC3; GIG2; Cell growthinhibiting gene 2 protein; Cell growth-inhibiting gene 2 protein; CD9 antigen; 5H9 antigen
|
||||
| Gene Name | CD9 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Tetraspanin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKS CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
||||
| Function |
Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||