Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZF0K2)

• DTT Name: C-X-C motif chemokine 2 (CXCL2)
• Synonyms: SCYB2; Macrophage inflammatory protein 2-alpha; MIP2A; MIP2-alpha; Growth-regulated protein beta; Growth regulatedprotein beta; Gro-beta; GROB; GRO2
• Gene Name: CXCL2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: CXC chemokine
• UniProt ID: CXCL2_HUMAN
• TTD ID: T96627
• Sequence:
  MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
  KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Function: Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Produced by activated monocytes and neutrophils and expressed at sites of inflammation.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Chemokine signaling pathway (hsa04062)
  NF-kappa B signaling pathway (hsa04064)
  NOD-like receptor signaling pathway (hsa04621)
  TNF signaling pathway (hsa04668)
  Salmonella infection (hsa05132)
  Legionellosis (hsa05134)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Laquinamod	DMMA0C7	Multiple sclerosis	8A40	Phase 3	[1]

References

• [1] Multiple sclerosis: current and future treatment options. Endocr Metab Immune Disord Drug Targets. 2007 Dec;7(4):292-9.