Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZJ5U9)

• DTT Name: Thioredoxin (TXN)
• Synonyms: Trx; TRX1; TRDX; Surface-associated sulphydryl protein; Surface associated sulphydryl protein; SASP; ATL-derived factor; ADF
• Gene Name: TXN
• DTT Type: Clinical trial target; [1]
• UniProt ID: THIO_HUMAN
• TTD ID: T85616
• Sequence:
  MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
  DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Function: Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.
• KEGG Pathway:
  NOD-like receptor signaling pathway (hsa04621)
  Parkinson disease (hsa05012)
  Salmonella infection (hsa05132)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)
  TP53 Regulates Metabolic Genes (R-HSA-5628897)
  The NLRP3 inflammasome (R-HSA-844456)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PX-12	DMLVHAJ	Pancreatic cancer	2C10	Phase 2	[1]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetate Ion	DMD08RH	Discovery agent	N.A.	Investigative	[2]
Cacodylate Ion	DMK4XLD	Discovery agent	N.A.	Investigative	[2]

References

• [1] 2-[(1-methylpropyl)dithio]-1H-imidazole inhibits tubulin polymerization through cysteine oxidation. Mol Cancer Ther. 2008 Jan;7(1):143-51.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.