Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE07EIQ)
| DME Name | General stress protein 14 (ywrO) | ||||
|---|---|---|---|---|---|
| Synonyms | Alkyl hydroperoxide reductase; Reductase alkyl hydroperoxide; GS protein 14; GSP14; BSU35990; ywrO | ||||
| Gene Name | ywrO | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| 3D Structure | |||||
| Gene ID | |||||
| EC Number | EC: 1.6.99.- | ||||
| Lineage | Species: Bacillus subtilis | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRI
VFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGAN HYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV |
||||
| Function | This enzyme has electron transfer activity, FMN binding, and NAD(P)H dehydrogenase (quinone) activity. | ||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Discontinued Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
