Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3YZC9)
| DME Name | Acetone carboxylase (ACX) | ||||
|---|---|---|---|---|---|
| Synonyms | Acetone:carbon-dioxide ligase; AMP-forming acetone:carbon-dioxide ligase; RCAP_rcc01338; acxC | ||||
| Gene Name | acxC | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| Gene ID | |||||
| EC Number | EC: 6.4.1.6 | ||||
| Lineage | Species: Rhodobacter capsulatus | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MAYTKAKIKDLVDGKIDRDTLHTMLATPKDADRFVMYLEVLQDQVPWEDRIILPLGPKLY
IVQRKSDHKWVVKSHAGHEFCDWRENWKLHAVMRVRETPEAMEEIYPRLMAPTAGWQVIR EYYCPLSGDLLDVEAPTPWYPVIHDFEPDIDAFYSEWLGLKIPERAA |
||||
| Function |
This enzyme catalyzes the carboxylation of acetone to form acetoacetate, and it has a reduced activity on butanone, and no activity on 2-pentatone, 3-pentatone, 2-hexanone, chloroacetone, pyruvate, phosphoenolpyruvate, acetaldehyde, propionaldehyde and propylene oxide. And it requires Mg2+ and ATP.
|
||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Preclinical Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
