Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4D159)

DME Name Nicotinate-nucleotide adenylyltransferase 1 (NMNAT1)
Synonyms
NMN adenylyltransferase 1; NMN/NaMN adenylyltransferase 1; NaMN adenylyltransferase 1; Nicotinamide-nucleotide adenylyltransferase 1; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1; NMNAT; NMNAT1
Gene Name NMNAT1
UniProt ID
NMNA1_HUMAN
INTEDE ID
DME0493
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
64802
EC Number EC: 2.7.7.1
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGL
IPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTL
ERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVAN
YGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
Function
This enzyme catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. It can also use the deamidated form; nicotinic acid mononucleotide (NaMN) and can use triazofurin monophosphate (TrMP) as substrate. It also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, it prefers NAD(+) and NaAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively.
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Reactome Pathway
Nicotinate metabolism (R-HSA-196807 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Namn DM1EZ3N Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Namn Discovery agent [N.A.] Investigative Km = 0.0145 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.47E-01 -4.22E-02 -1.72E-01
Alopecia ED70 Skin from scalp 9.52E-04 2.68E-01 6.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.71E-02 -3.60E-02 -2.16E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.83E-03 2.50E-01 1.19E+00
Aortic stenosis BB70 Calcified aortic valve 5.16E-01 -1.12E-01 -4.57E-01
Apnea 7A40 Hyperplastic tonsil 1.80E-01 -2.11E-01 -8.13E-01
Arthropathy FA00-FA5Z Peripheral blood 9.42E-01 6.20E-03 2.66E-02
Asthma CA23 Nasal and bronchial airway 1.25E-07 4.53E-01 6.47E-01
Atopic dermatitis EA80 Skin 2.29E-01 9.81E-02 3.02E-01
Autism 6A02 Whole blood 4.78E-01 -2.25E-02 -1.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.03E-01 -1.25E-01 -3.66E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.83E-01 -6.12E-01 -1.39E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.34E-04 -1.66E-01 -5.60E-01
Batten disease 5C56.1 Whole blood 5.13E-02 -1.04E-01 -6.44E-01
Behcet's disease 4A62 Peripheral blood 3.93E-01 6.16E-02 3.18E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.80E-02 1.39E-01 7.59E-01
Bladder cancer 2C94 Bladder tissue 2.10E-03 -1.18E+00 -2.09E+00
Breast cancer 2C60-2C6Z Breast tissue 5.12E-04 1.26E-01 2.79E-01
Cardioembolic stroke 8B11.20 Whole blood 3.69E-06 4.45E-01 1.10E+00
Cervical cancer 2C77 Cervical tissue 6.53E-02 -1.25E-01 -2.82E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.13E-01 -5.45E-02 -1.99E-01
Chronic hepatitis C 1E51.1 Whole blood 1.78E-01 -1.51E-01 -8.88E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.91E-01 -4.61E-02 -1.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.23E-02 -7.93E-02 -3.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.35E-03 3.87E-01 1.69E+00
Colon cancer 2B90 Colon tissue 2.62E-38 -5.92E-01 -1.55E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.80E-01 -5.54E-02 -7.51E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.83E-01 -1.71E-02 -2.77E-02
Endometriosis GA10 Endometrium tissue 3.88E-04 -4.31E-01 -8.10E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.16E-01 -3.25E-02 -2.57E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.44E-06 6.36E-01 1.58E+00
Gastric cancer 2B72 Gastric tissue 2.02E-01 6.42E-01 1.16E+00
Glioblastopma 2A00.00 Nervous tissue 9.85E-02 -4.35E-02 -1.12E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.57E-01 -3.88E-01 -2.32E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.21E-01 -4.10E-01 -7.29E-01
Head and neck cancer 2D42 Head and neck tissue 9.17E-08 -2.26E-01 -1.09E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.96E-02 -7.36E-02 -4.61E-01
Huntington's disease 8A01.10 Whole blood 6.78E-01 1.29E-02 1.04E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.30E-01 2.45E-01 8.53E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.01E-02 1.70E-01 1.21E+00
Influenza 1E30 Whole blood 1.09E-04 -1.04E+00 -6.93E+00
Interstitial cystitis GC00.3 Bladder tissue 3.02E-03 -3.93E-01 -3.37E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.43E-02 4.13E-01 1.21E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.16E-01 -9.84E-03 -3.25E-02
Ischemic stroke 8B11 Peripheral blood 9.50E-01 -2.11E-02 -7.10E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.60E-01 9.27E-03 2.49E-02
Lateral sclerosis 8B60.4 Skin 4.45E-01 2.24E-02 3.73E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.65E-01 8.66E-02 4.86E-01
Liver cancer 2C12.0 Liver tissue 3.40E-01 2.44E-02 6.91E-02
Liver failure DB99.7-DB99.8 Liver tissue 2.00E-02 -1.16E-01 -8.81E-01
Lung cancer 2C25 Lung tissue 4.67E-02 2.16E-02 8.17E-02
Lupus erythematosus 4A40 Whole blood 2.45E-01 3.14E-02 7.69E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.38E-01 4.54E-02 2.42E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.33E-01 -4.79E-02 -1.11E-01
Melanoma 2C30 Skin 3.27E-01 -2.81E-01 -3.59E-01
Multiple myeloma 2A83.1 Peripheral blood 3.29E-01 -1.77E-01 -5.29E-01
Multiple myeloma 2A83.1 Bone marrow 2.30E-05 1.00E-01 1.82E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.61E-02 -7.41E-01 -1.18E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.40E-03 1.28E-01 4.08E-01
Myelofibrosis 2A20.2 Whole blood 5.35E-04 -4.56E-01 -2.16E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.08E-01 1.88E-01 2.74E-01
Myopathy 8C70.6 Muscle tissue 7.46E-01 -1.06E-01 -2.18E-01
Neonatal sepsis KA60 Whole blood 1.59E-30 7.23E-01 2.25E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.91E-01 -1.97E-01 -5.08E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.66E-01 -2.02E-02 -1.55E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.67E-01 -2.51E-02 -9.66E-02
Olive pollen allergy CA08.00 Peripheral blood 4.39E-01 1.90E-01 3.85E-01
Oral cancer 2B6E Oral tissue 9.40E-01 -1.49E-01 -2.54E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.43E-01 3.50E-01 5.55E-01
Osteoporosis FB83.1 Bone marrow 8.08E-01 1.60E-01 7.62E-01
Ovarian cancer 2C73 Ovarian tissue 5.02E-02 2.11E-01 6.35E-01
Pancreatic cancer 2C10 Pancreas 2.04E-03 2.87E-01 8.62E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.08E-01 1.12E-01 5.87E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.67E-02 2.27E-01 1.04E+00
Pituitary cancer 2D12 Pituitary tissue 4.22E-01 9.00E-02 3.91E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.34E-01 1.07E-01 5.29E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.48E-01 6.17E-02 1.59E-01
Polycythemia vera 2A20.4 Whole blood 2.21E-06 -2.48E-01 -1.52E+00
Pompe disease 5C51.3 Biceps muscle 9.30E-05 -8.82E-01 -2.33E+00
Preterm birth KA21.4Z Myometrium 7.31E-01 -6.09E-02 -2.37E-01
Prostate cancer 2C82 Prostate 4.50E-01 3.49E-01 5.20E-01
Psoriasis EA90 Skin 6.67E-03 7.66E-02 2.32E-01
Rectal cancer 2B92 Rectal colon tissue 3.12E-03 -4.69E-01 -2.36E+00
Renal cancer 2C90-2C91 Kidney 7.57E-05 -2.23E-01 -1.50E+00
Retinoblastoma 2D02.2 Uvea 1.08E-08 1.77E+00 1.13E+01
Rheumatoid arthritis FA20 Synovial tissue 4.72E-01 7.85E-02 1.27E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.01E-01 7.25E-04 3.57E-03
Schizophrenia 6A20 Prefrontal cortex 9.93E-01 1.28E-03 2.64E-03
Schizophrenia 6A20 Superior temporal cortex 5.70E-01 2.31E-02 2.60E-01
Scleroderma 4A42.Z Whole blood 1.16E-03 1.97E-01 1.59E+00
Seizure 8A60-8A6Z Whole blood 2.71E-01 -2.05E-02 -1.00E-01
Sensitive skin EK0Z Skin 4.50E-01 -2.01E-02 -1.87E-01
Sepsis with septic shock 1G41 Whole blood 2.40E-53 7.28E-01 1.90E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.83E-01 -1.21E-01 -1.83E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.55E-01 -1.06E-01 -6.15E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.63E-01 -7.97E-02 -2.50E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.89E-01 3.28E-01 1.25E+00
Skin cancer 2C30-2C3Z Skin 1.95E-06 2.63E-01 6.05E-01
Thrombocythemia 3B63 Whole blood 1.56E-04 -4.07E-01 -2.13E+00
Thrombocytopenia 3B64 Whole blood 1.38E-01 -8.28E-02 -2.01E-01
Thyroid cancer 2D10 Thyroid 5.47E-17 -4.45E-01 -1.30E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.96E-01 -5.32E-02 -1.38E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.31E-01 -3.25E-01 -9.25E-01
Type 2 diabetes 5A11 Liver tissue 4.47E-01 2.61E-01 7.76E-01
Ureter cancer 2C92 Urothelium 6.81E-01 -8.34E-02 -6.68E-01
Uterine cancer 2C78 Endometrium tissue 3.31E-05 -2.33E-01 -4.29E-01
Vitiligo ED63.0 Skin 2.67E-01 -1.99E-01 -7.56E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Initial-rate kinetics of human NMN-adenylyltransferases: substrate and metal ion specificity, inhibition by products and multisubstrate analogues, and isozyme contributions to NAD+ biosynthesis. Biochemistry. 2007 Apr 24;46(16):4912-22.