General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5EGK0)

DME Name Prolyl 4-hydroxylase alpha-2 (P4HA2)
Synonyms Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2; Prolyl 4-hydroxylase subunit alpha-2; 4-PH alpha-2; P4HA2; UNQ290/PRO330
Gene Name P4HA2
UniProt ID
P4HA2_HUMAN
INTEDE ID
DME0460
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
8974
EC Number EC: 1.14.11.2
Oxidoreductase
Oxygen paired donor oxidoreductase
2-oxoglutarate donor oxidoreductase
EC: 1.14.11.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKS
WANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQR
QFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEG
DYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSH
ERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVK
LTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPK
LARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN
YGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKK
GTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD
Function This enzyme catalyzes the post-translational formation of 4- hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Collagen biosynthesis and modifying enzymes (R-HSA-1650814 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin C DMXJ7O8 Adenocarcinoma 2D40 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-ketoglutaric acid Discovery agent [N.A.] Investigative Km = 0.022 microM [1]
Vitamin C Adenocarcinoma [2D40] Approved Km = 0.33 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.97E-08 -1.22E-01 -3.64E-01
Alopecia ED70 Skin from scalp 4.92E-02 -5.21E-02 -2.92E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.08E-01 2.07E-02 7.89E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.54E-01 8.85E-02 4.36E-01
Aortic stenosis BB70 Calcified aortic valve 6.40E-01 3.27E-01 4.86E-01
Apnea 7A40 Hyperplastic tonsil 2.71E-01 -1.01E-01 -3.83E-01
Arthropathy FA00-FA5Z Peripheral blood 1.47E-02 1.22E-01 1.19E+00
Asthma CA23 Nasal and bronchial airway 2.01E-05 -3.57E-01 -6.90E-01
Atopic dermatitis EA80 Skin 2.30E-03 -1.26E-01 -6.73E-01
Autism 6A02 Whole blood 3.83E-02 -8.74E-02 -4.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.00E-01 -7.99E-02 -7.89E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.11E-01 -2.41E-02 -1.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.76E-03 9.62E-02 4.26E-01
Batten disease 5C56.1 Whole blood 1.43E-01 7.69E-02 7.56E-01
Behcet's disease 4A62 Peripheral blood 5.42E-01 -6.50E-02 -3.68E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.14E-01 -4.66E-02 -3.51E-01
Bladder cancer 2C94 Bladder tissue 3.67E-03 -2.92E-01 -1.95E+00
Breast cancer 2C60-2C6Z Breast tissue 1.98E-54 3.17E-01 1.13E+00
Cardioembolic stroke 8B11.20 Whole blood 2.93E-08 3.93E-01 1.96E+00
Cervical cancer 2C77 Cervical tissue 2.70E-01 -1.12E-01 -4.60E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.02E-01 -1.15E-01 -4.56E-01
Chronic hepatitis C 1E51.1 Whole blood 2.47E-01 -3.80E-02 -3.79E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.98E-01 -5.14E-02 -2.77E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.57E-02 5.13E-02 1.71E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.60E-02 -3.08E-01 -7.20E-01
Colon cancer 2B90 Colon tissue 1.49E-01 -3.59E-02 -1.86E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.74E-01 -1.43E-01 -4.24E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.21E-01 -3.69E-02 -1.00E-01
Endometriosis GA10 Endometrium tissue 6.89E-04 -3.40E-01 -8.58E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.79E-01 3.63E-02 2.52E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.01E-01 -1.43E-01 -6.73E-01
Gastric cancer 2B72 Gastric tissue 1.91E-01 8.79E-02 7.78E-01
Glioblastopma 2A00.00 Nervous tissue 1.18E-01 -3.06E-02 -8.11E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.18E-01 -1.73E-01 -1.38E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.00E-01 5.76E-02 1.46E-01
Head and neck cancer 2D42 Head and neck tissue 1.50E-05 4.97E-01 9.83E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.55E-01 -1.09E-03 -2.05E-03
Huntington's disease 8A01.10 Whole blood 7.82E-01 1.84E-02 2.34E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.35E-01 2.10E-01 7.61E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.88E-01 3.67E-02 3.80E-01
Influenza 1E30 Whole blood 1.78E-01 -2.19E-01 -1.14E+00
Interstitial cystitis GC00.3 Bladder tissue 5.82E-01 1.37E-01 6.97E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.92E-04 4.41E-01 2.02E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.71E-01 -4.70E-02 -3.29E-01
Ischemic stroke 8B11 Peripheral blood 2.45E-01 5.91E-02 5.09E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.25E-01 5.83E-02 2.80E-01
Lateral sclerosis 8B60.4 Skin 1.05E-01 -1.28E-01 -1.56E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.99E-03 -4.08E-01 -1.35E+00
Liver cancer 2C12.0 Liver tissue 5.82E-19 5.66E-01 2.21E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.35E-02 2.82E-01 1.83E+00
Lung cancer 2C25 Lung tissue 2.28E-01 1.01E-02 5.00E-02
Lupus erythematosus 4A40 Whole blood 6.40E-01 6.12E-03 2.28E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.16E-01 -1.79E-02 -1.40E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.51E-03 1.25E-01 7.27E-01
Melanoma 2C30 Skin 9.42E-01 1.16E-01 2.00E-01
Multiple myeloma 2A83.1 Peripheral blood 9.45E-01 -3.64E-03 -4.59E-03
Multiple myeloma 2A83.1 Bone marrow 7.90E-03 2.56E-01 1.02E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.22E-01 -1.36E-01 -3.99E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.17E-15 -1.35E+00 -3.19E+00
Myelofibrosis 2A20.2 Whole blood 6.21E-03 2.36E-01 1.66E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.80E-01 8.41E-02 2.81E-01
Myopathy 8C70.6 Muscle tissue 2.83E-02 2.33E-01 9.03E-01
Neonatal sepsis KA60 Whole blood 3.33E-10 2.21E-01 1.14E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.11E-05 5.50E-01 1.92E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.88E-02 -1.69E-01 -1.23E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.45E-02 -1.03E-01 -6.82E-01
Olive pollen allergy CA08.00 Peripheral blood 6.62E-01 -2.73E-02 -9.95E-02
Oral cancer 2B6E Oral tissue 2.26E-07 4.73E-01 1.15E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.88E-01 2.95E-01 4.58E-01
Osteoporosis FB83.1 Bone marrow 9.88E-02 3.41E-01 1.33E+00
Ovarian cancer 2C73 Ovarian tissue 1.52E-02 8.09E-01 1.20E+00
Pancreatic cancer 2C10 Pancreas 9.57E-01 -1.21E-01 -2.35E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.62E-02 2.15E-01 6.73E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.74E-03 9.17E-02 1.09E+00
Pituitary cancer 2D12 Pituitary tissue 5.50E-02 2.34E-01 8.83E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.99E-01 1.18E-01 4.32E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.63E-01 -6.66E-02 -7.13E-01
Polycythemia vera 2A20.4 Whole blood 1.67E-15 2.49E-01 1.89E+00
Pompe disease 5C51.3 Biceps muscle 8.64E-01 5.64E-02 3.77E-01
Preterm birth KA21.4Z Myometrium 5.12E-01 9.76E-02 4.01E-01
Prostate cancer 2C82 Prostate 4.11E-02 -2.12E-01 -4.36E-01
Psoriasis EA90 Skin 1.65E-12 -2.73E-01 -9.74E-01
Rectal cancer 2B92 Rectal colon tissue 2.05E-02 -2.46E-01 -1.06E+00
Renal cancer 2C90-2C91 Kidney 3.80E-02 3.98E-01 6.43E-01
Retinoblastoma 2D02.2 Uvea 2.82E-07 8.63E-01 3.79E+00
Rheumatoid arthritis FA20 Synovial tissue 3.26E-02 5.47E-01 1.47E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.72E-01 -1.02E-01 -5.39E-01
Schizophrenia 6A20 Prefrontal cortex 1.62E-01 -8.09E-02 -1.36E-01
Schizophrenia 6A20 Superior temporal cortex 5.56E-02 9.51E-02 9.22E-01
Scleroderma 4A42.Z Whole blood 1.71E-01 3.34E-02 2.31E-01
Seizure 8A60-8A6Z Whole blood 9.82E-01 -3.21E-02 -1.60E-01
Sensitive skin EK0Z Skin 7.57E-02 -8.09E-02 -9.01E-01
Sepsis with septic shock 1G41 Whole blood 1.44E-21 2.37E-01 1.05E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.54E-02 -3.42E-01 -7.56E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.70E-02 7.58E-02 5.09E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.82E-03 5.29E-01 2.63E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.55E-01 2.25E-02 7.20E-02
Skin cancer 2C30-2C3Z Skin 7.72E-03 -4.07E-02 -1.33E-01
Thrombocythemia 3B63 Whole blood 1.05E-05 1.87E-01 1.35E+00
Thrombocytopenia 3B64 Whole blood 2.25E-01 1.56E-01 8.79E-01
Thyroid cancer 2D10 Thyroid 3.24E-70 9.63E-01 3.29E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.48E-05 4.86E-01 1.48E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.07E-01 1.19E-02 4.27E-01
Type 2 diabetes 5A11 Liver tissue 1.18E-01 1.28E-01 9.13E-01
Ureter cancer 2C92 Urothelium 8.78E-02 7.80E-02 9.50E-01
Uterine cancer 2C78 Endometrium tissue 2.38E-18 -4.91E-01 -1.18E+00
Vitiligo ED63.0 Skin 3.00E-01 -5.34E-02 -3.14E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Prolyl 4-hydroxylases, the key enzymes of collagen biosynthesis. Matrix Biol. 2003 Mar;22(1):15-24.