General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5NGOW)

DME Name Choline O-acetyltransferase (CHAT)
Synonyms Choline acetylase; CHOACTase; CHOACTASE; CMS1A; CMS1A2; CMS6; CHAT; ChAT
Gene Name CHAT
UniProt ID
CLAT_HUMAN
INTEDE ID
DME0102
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1103
EC Number EC: 2.3.1.6
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPH
PRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKMA
AKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQ
QKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLIS
GVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPE
PEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSE
WAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANR
WYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAP
RRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQ
LAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLL
KDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQV
PTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRD
LCSLLPPTESKPLATKEKATRPSQGHQP
Function This enzyme catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses.
KEGG Pathway
Cholinergic synapse (hsa04725 )
Glycerophospholipid metabolism (hsa00564 )
Reactome Pathway
Synthesis of PC (R-HSA-1483191 )
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Choline salicylate DM8P137 Inflammation 1A00-CA43.1 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.55E-01 3.11E-02 1.28E-01
Alopecia ED70 Skin from scalp 2.39E-01 -5.88E-02 -2.58E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.00E-01 -5.18E-02 -2.92E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.93E-01 -8.31E-03 -7.98E-02
Aortic stenosis BB70 Calcified aortic valve 3.06E-01 1.57E-01 4.06E-01
Apnea 7A40 Hyperplastic tonsil 4.78E-01 2.57E-02 1.63E-01
Arthropathy FA00-FA5Z Peripheral blood 3.10E-02 1.59E-01 1.05E+00
Asthma CA23 Nasal and bronchial airway 9.99E-03 -8.04E-02 -2.64E-01
Atopic dermatitis EA80 Skin 1.15E-03 6.92E-02 8.09E-01
Autism 6A02 Whole blood 2.53E-01 -4.44E-02 -1.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.65E-01 -3.68E-02 -3.39E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.43E-01 1.31E-01 6.66E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.40E-01 -2.85E-02 -9.43E-02
Batten disease 5C56.1 Whole blood 4.43E-01 -6.06E-02 -4.64E-01
Behcet's disease 4A62 Peripheral blood 9.18E-02 9.11E-02 5.21E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.47E-01 -2.76E-02 -1.88E-01
Bladder cancer 2C94 Bladder tissue 3.86E-05 7.97E-01 3.52E+00
Breast cancer 2C60-2C6Z Breast tissue 4.01E-06 -9.80E-02 -3.07E-01
Cardioembolic stroke 8B11.20 Whole blood 4.38E-02 9.29E-02 4.39E-01
Cervical cancer 2C77 Cervical tissue 4.52E-02 -8.76E-02 -6.24E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.80E-01 1.47E-02 5.36E-02
Chronic hepatitis C 1E51.1 Whole blood 5.81E-01 -3.99E-02 -1.87E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.87E-02 1.09E-01 4.79E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.33E-02 6.04E-02 2.60E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.18E-01 -5.52E-02 -5.63E-01
Colon cancer 2B90 Colon tissue 1.69E-09 1.04E-01 4.83E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.77E-01 -1.06E-01 -1.24E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.21E-01 -7.43E-02 -3.52E-01
Endometriosis GA10 Endometrium tissue 8.88E-01 7.92E-04 2.71E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.89E-01 9.54E-03 5.83E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.77E-05 -3.39E-01 -1.57E+00
Gastric cancer 2B72 Gastric tissue 3.00E-01 -1.75E-01 -6.36E-01
Glioblastopma 2A00.00 Nervous tissue 2.97E-09 1.29E-01 4.17E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.63E-01 -1.32E-01 -8.46E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.08E-09 -8.66E-01 -4.27E+00
Head and neck cancer 2D42 Head and neck tissue 3.13E-02 4.26E-02 1.98E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.71E-01 -5.30E-02 -3.04E-01
Huntington's disease 8A01.10 Whole blood 2.04E-01 1.27E-01 4.66E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.53E-01 -7.38E-02 -3.60E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.35E-01 4.71E-02 3.19E-01
Influenza 1E30 Whole blood 1.32E-01 1.04E-01 4.47E-01
Interstitial cystitis GC00.3 Bladder tissue 7.57E-01 7.83E-02 7.11E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.99E-01 -2.11E-02 -1.41E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.68E-01 -4.38E-03 -2.14E-02
Ischemic stroke 8B11 Peripheral blood 7.11E-01 2.26E-03 1.45E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 8.61E-01 1.26E-02 4.28E-02
Lateral sclerosis 8B60.4 Skin 1.97E-01 2.52E-01 1.11E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.95E-01 -7.59E-02 -4.50E-01
Liver cancer 2C12.0 Liver tissue 5.58E-07 -1.99E-01 -7.87E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.38E-01 9.38E-02 6.21E-01
Lung cancer 2C25 Lung tissue 1.49E-04 -9.30E-02 -4.00E-01
Lupus erythematosus 4A40 Whole blood 1.94E-02 -1.07E-01 -2.01E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.40E-01 7.84E-02 5.17E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.59E-01 5.90E-02 2.37E-01
Melanoma 2C30 Skin 8.78E-01 2.13E-01 3.52E-01
Multiple myeloma 2A83.1 Peripheral blood 4.03E-01 3.47E-02 2.25E-01
Multiple myeloma 2A83.1 Bone marrow 3.55E-02 -2.12E-01 -8.50E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.79E-01 2.52E-02 1.41E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.01E-01 1.15E-02 5.12E-02
Myelofibrosis 2A20.2 Whole blood 6.06E-04 -2.14E-01 -1.84E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.03E-01 1.52E-01 3.26E-01
Myopathy 8C70.6 Muscle tissue 7.07E-01 -6.58E-02 -4.21E-01
Neonatal sepsis KA60 Whole blood 4.36E-03 -1.24E-01 -4.69E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.74E-05 -7.66E-01 -2.67E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.39E-01 -1.16E-01 -4.73E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.82E-01 -3.06E-02 -3.25E-01
Olive pollen allergy CA08.00 Peripheral blood 1.42E-01 -1.01E-02 -1.43E-01
Oral cancer 2B6E Oral tissue 2.65E-02 -2.35E-01 -8.56E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.71E-02 9.94E-02 4.39E-01
Osteoporosis FB83.1 Bone marrow 2.28E-01 2.21E-01 2.14E+00
Ovarian cancer 2C73 Ovarian tissue 1.18E-01 -1.08E-01 -2.92E-01
Pancreatic cancer 2C10 Pancreas 5.83E-04 -4.12E-01 -1.39E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.21E-01 3.57E-02 1.91E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.40E-01 2.99E-02 2.44E-01
Pituitary cancer 2D12 Pituitary tissue 6.65E-02 -2.64E-01 -9.15E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.29E-02 -2.56E-01 -9.08E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.76E-01 2.89E-02 2.52E-01
Polycythemia vera 2A20.4 Whole blood 3.65E-13 -2.40E-01 -2.03E+00
Pompe disease 5C51.3 Biceps muscle 1.49E-01 -1.09E-01 -8.18E-01
Preterm birth KA21.4Z Myometrium 1.63E-01 -1.31E-01 -6.24E-01
Prostate cancer 2C82 Prostate 1.80E-02 -3.61E-01 -7.47E-01
Psoriasis EA90 Skin 1.60E-02 -1.37E-01 -3.50E-01
Rectal cancer 2B92 Rectal colon tissue 7.94E-01 -2.27E-02 -1.47E-01
Renal cancer 2C90-2C91 Kidney 4.14E-01 -7.81E-02 -2.58E-01
Retinoblastoma 2D02.2 Uvea 1.07E-02 -2.38E-01 -1.28E+00
Rheumatoid arthritis FA20 Synovial tissue 8.76E-02 2.74E-01 9.38E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.12E-02 -3.75E-02 -2.60E-01
Schizophrenia 6A20 Prefrontal cortex 7.44E-01 2.91E-02 1.03E-01
Schizophrenia 6A20 Superior temporal cortex 7.45E-01 -2.84E-02 -2.30E-01
Scleroderma 4A42.Z Whole blood 1.39E-01 -5.71E-02 -5.51E-01
Seizure 8A60-8A6Z Whole blood 9.52E-01 -7.68E-03 -7.11E-02
Sensitive skin EK0Z Skin 8.46E-01 -2.81E-02 -1.80E-01
Sepsis with septic shock 1G41 Whole blood 1.04E-02 3.69E-02 1.60E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.04E-02 7.30E-01 1.55E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.70E-01 -2.03E-02 -1.14E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.25E-01 -2.18E-02 -2.09E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.03E-01 -2.84E-01 -1.53E+00
Skin cancer 2C30-2C3Z Skin 7.36E-04 -1.72E-01 -4.53E-01
Thrombocythemia 3B63 Whole blood 8.64E-05 -1.91E-01 -1.81E+00
Thrombocytopenia 3B64 Whole blood 7.55E-01 -6.87E-03 -3.69E-02
Thyroid cancer 2D10 Thyroid 4.32E-02 5.63E-02 2.44E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.55E-01 5.08E-02 2.77E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.44E-02 1.97E-01 2.64E+00
Type 2 diabetes 5A11 Liver tissue 9.60E-01 1.30E-01 4.62E-01
Ureter cancer 2C92 Urothelium 6.60E-01 5.52E-04 2.19E-03
Uterine cancer 2C78 Endometrium tissue 2.52E-09 -2.47E-01 -9.09E-01
Vitiligo ED63.0 Skin 4.18E-01 4.50E-03 3.07E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Choline acetylase DTT Info

References

1 The effect of trichlorfon and methylazoxymethanol on the development of guinea pig cerebellum. Toxicol Appl Pharmacol. 2007 Mar;219(2-3):128-35.