Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE69QHT)
| DME Name | Aminoglycoside acetyltransferase (aac) | ||||
|---|---|---|---|---|---|
| Synonyms | Aminoglycoside 2'-N-acetyltransferase; AAC(2')-Ia; aac | ||||
| Gene Name | aac | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| 3D Structure | |||||
| Gene ID | |||||
| EC Number | EC: 2.3.1.59 | ||||
| Lineage | Species: Providencia stuartii | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence | 
                                         
                        MGIEYRSLHTSQLTLSEKEALYDLLIEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVA 
                    
                IIQRHMALDNTPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLGLLSASDDGQ KLYHSVGWQIWKGKLFELKQGSYIRSIEEEGGVMGWKADGEVDFTASLYCDFRGGDQW  | 
            ||||
| Function | This enzyme catalyzes the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides. | ||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Approved Drug(s) Metabolized by This DME 
                                            
  | 
            ||||||||||||||||||||||||||||
