Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE84PFW)
| DME Name | Cardiac glycoside reductase 1 (cgr1) | ||||
|---|---|---|---|---|---|
| Synonyms | Cardiac glycoside reductase operon protein 1; Cytochrome c-type protein Cgr1; cgr1 | ||||
| Gene Name | cgr1 | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| 3D Structure | |||||
| Gene ID | |||||
| EC Number | EC: 1.3.2.- | ||||
| Lineage | Species: Eggerthella lenta | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MAEEPVVIGDPAPRTRKWPIVVGVVVVVLIAAGAGFWVWHEQPSFCAAICHTPMDEYLET
YEQEAGTAGVDKWGNEVANTNAMLAVSHKAQGKDCMACHVPTLSEQMSEGMNWVTGNYVY PLEERDTEMLTEARGVDADEFCLNESCHNLTRDDLIKATSDMEFNPHQPQHGEIECSECH KAHRASVMYCTQCHSEAEVPEGWLTVAEANKLSTAA |
||||
| Function | This enzyme anchors as a dimer in the cytoplasmic membrane and shuttles quinone derived electrons to associated periplasmic nitrite reductases. | ||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
