Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8DP90)

DME Name Semicarbazide-sensitive amine oxidase (AOC2)
Synonyms Amine oxidase [copper-containing]; Retina-specific copper amine oxidase; SSAO; AOC2; RAO
Gene Name AOC2
UniProt ID
AOC2_HUMAN
INTEDE ID
DME0477
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
314
EC Number EC: 1.4.3.21
Oxidoreductase
CH-NH2 donor oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.4.3.21
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLS
REELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREA
LAIVLFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLK
EVELPKAPIFLSSTFNYNGSTLAAVHATPRGLRSGDRATWMALYHNISGVGLFLHPVGLE
LLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN
SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQGERIAYEVSVQ
ECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALE
GRVHATGYINTAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDV
VFKPVAAPWNPEHWLQRPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYR
IQIHSPLGIHIPLESDMERALSWGRYQLVVTQRKEEESQSSSIYHQNDIWTPTVTFADFI
NNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVY
FEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF
Function This enzyme has a monoamine oxidase activity with substrate specificity for 2-phenylethylamine and tryptamine.
KEGG Pathway
Glycine, serine and threonine metabolism (hsa00260 )
Metabolic pathways (hsa01100 )
Phenylalanine metabolism (hsa00360 )
Tyrosine metabolism (hsa00350 )
beta-Alanine metabolism (hsa00410 )
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Benzylamine DMRM6ES N. A. N. A. Investigative [1]
Methylamine DMTPL4W N. A. N. A. Investigative [1]
PHENETHYLAMINE DMX0G4F Discovery agent N.A. Investigative [1]
tyramine DM4UXT1 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
PHENETHYLAMINE Discovery agent [N.A.] Investigative Km = 0.077 microM [1]
tyramine Discovery agent [N.A.] Investigative Km = 0.056 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.47E-07 -1.63E-01 -6.44E-01
Alopecia ED70 Skin from scalp 2.71E-01 8.04E-02 1.98E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.37E-02 8.74E-02 3.03E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.41E-01 -5.18E-02 -5.61E-01
Aortic stenosis BB70 Calcified aortic valve 9.56E-02 2.04E-01 6.20E-01
Apnea 7A40 Hyperplastic tonsil 8.89E-01 -2.21E-02 -9.18E-02
Arthropathy FA00-FA5Z Peripheral blood 7.63E-01 6.02E-03 1.09E-02
Asthma CA23 Nasal and bronchial airway 7.63E-03 4.40E-02 5.66E-02
Atopic dermatitis EA80 Skin 5.24E-07 3.26E-01 1.18E+00
Autism 6A02 Whole blood 7.96E-01 4.52E-02 1.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.87E-02 2.19E-01 1.17E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.61E-03 -1.96E+00 -2.37E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.71E-03 -1.13E-01 -3.83E-01
Batten disease 5C56.1 Whole blood 3.21E-01 -5.90E-02 -3.01E-01
Behcet's disease 4A62 Peripheral blood 3.92E-01 -4.25E-04 -2.00E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.92E-01 1.47E-01 5.85E-01
Bladder cancer 2C94 Bladder tissue 4.09E-04 4.98E-01 2.14E+00
Breast cancer 2C60-2C6Z Breast tissue 7.12E-30 -3.87E-01 -6.91E-01
Cardioembolic stroke 8B11.20 Whole blood 4.74E-05 6.65E-01 1.42E+00
Cervical cancer 2C77 Cervical tissue 2.20E-01 -3.27E-02 -1.19E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.37E-01 1.51E-01 7.45E-02
Chronic hepatitis C 1E51.1 Whole blood 8.70E-02 8.05E-02 4.61E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.48E-01 6.52E-02 3.57E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.44E-01 -2.67E-02 -9.03E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.16E-01 5.14E-02 1.01E-01
Colon cancer 2B90 Colon tissue 9.83E-12 1.14E-01 4.90E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.22E-01 -1.59E-01 -8.96E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.79E-02 1.17E-01 7.82E-01
Endometriosis GA10 Endometrium tissue 1.54E-02 1.98E-01 6.90E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.47E-01 -2.74E-02 -1.77E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.06E-14 -1.39E+00 -1.79E+00
Gastric cancer 2B72 Gastric tissue 6.97E-01 -4.17E-01 -8.82E-01
Glioblastopma 2A00.00 Nervous tissue 1.25E-09 -1.15E-01 -3.48E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.76E-01 -9.24E-01 -1.77E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.27E-02 4.07E-01 6.85E-01
Head and neck cancer 2D42 Head and neck tissue 1.26E-01 -7.78E-02 -3.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.46E-01 -9.26E-02 -4.00E-01
Huntington's disease 8A01.10 Whole blood 1.94E-01 6.34E-02 5.87E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.64E-02 -4.48E-01 -1.10E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.43E-01 -1.36E-02 -1.18E-01
Influenza 1E30 Whole blood 5.18E-01 5.16E-02 6.14E-01
Interstitial cystitis GC00.3 Bladder tissue 4.05E-02 -4.35E-01 -1.54E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.28E-01 2.79E-01 4.41E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.47E-03 9.02E-02 3.47E-01
Ischemic stroke 8B11 Peripheral blood 2.83E-01 8.56E-03 5.79E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.08E-01 -8.54E-02 -6.99E-02
Lateral sclerosis 8B60.4 Skin 4.01E-01 2.12E-02 1.50E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.97E-01 2.17E-01 4.23E-01
Liver cancer 2C12.0 Liver tissue 5.47E-01 4.73E-02 1.47E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.80E-01 -2.42E-02 -6.60E-02
Lung cancer 2C25 Lung tissue 2.13E-05 -1.84E-01 -6.56E-01
Lupus erythematosus 4A40 Whole blood 3.21E-01 4.96E-02 6.29E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.67E-01 8.39E-02 3.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.68E-01 1.92E-02 3.83E-02
Melanoma 2C30 Skin 9.80E-01 -2.91E-02 -4.63E-02
Multiple myeloma 2A83.1 Peripheral blood 5.24E-01 2.63E-03 1.79E-02
Multiple myeloma 2A83.1 Bone marrow 8.90E-02 -1.48E-01 -7.55E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.90E-01 8.03E-02 3.97E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.81E-02 -4.51E-02 -2.14E-01
Myelofibrosis 2A20.2 Whole blood 3.14E-01 -2.11E-01 -1.19E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.18E-03 9.45E-01 8.35E-01
Myopathy 8C70.6 Muscle tissue 1.38E-01 -5.05E-02 -3.60E-01
Neonatal sepsis KA60 Whole blood 7.08E-09 -5.18E-01 -9.12E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.33E-03 -6.01E-01 -1.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.24E-01 6.59E-02 4.64E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.70E-02 4.70E-01 1.34E+00
Olive pollen allergy CA08.00 Peripheral blood 5.08E-01 -2.58E-02 -1.95E-01
Oral cancer 2B6E Oral tissue 2.10E-03 -1.89E-01 -5.76E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.77E-01 8.67E-01 4.95E-01
Osteoporosis FB83.1 Bone marrow 1.65E-01 5.93E-02 4.97E-01
Ovarian cancer 2C73 Ovarian tissue 3.15E-01 -3.46E-01 -8.15E-01
Pancreatic cancer 2C10 Pancreas 1.01E-01 -8.78E-02 -1.72E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.61E-01 1.67E-01 8.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.45E-01 8.08E-02 5.68E-01
Pituitary cancer 2D12 Pituitary tissue 4.75E-01 0.00E+00 0.00E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.09E-01 5.52E-02 1.47E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.32E-01 -4.10E-02 -2.32E-01
Polycythemia vera 2A20.4 Whole blood 4.03E-02 1.28E-01 5.52E-01
Pompe disease 5C51.3 Biceps muscle 1.75E-02 -1.17E-01 -1.08E+00
Preterm birth KA21.4Z Myometrium 4.35E-01 -6.44E-03 -2.66E-02
Prostate cancer 2C82 Prostate 3.66E-02 -4.37E-01 -7.11E-01
Psoriasis EA90 Skin 2.15E-02 8.11E-02 1.94E-01
Rectal cancer 2B92 Rectal colon tissue 2.69E-01 7.87E-02 3.03E-01
Renal cancer 2C90-2C91 Kidney 7.34E-02 -2.22E-01 -4.11E-01
Retinoblastoma 2D02.2 Uvea 3.56E-02 -2.55E-01 -1.14E+00
Rheumatoid arthritis FA20 Synovial tissue 9.91E-06 5.17E-01 3.15E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.89E-01 -5.31E-03 -3.40E-02
Schizophrenia 6A20 Prefrontal cortex 3.62E-01 8.79E-02 2.56E-01
Schizophrenia 6A20 Superior temporal cortex 6.09E-01 2.73E-02 1.40E-01
Scleroderma 4A42.Z Whole blood 5.25E-02 3.80E-01 1.39E+00
Seizure 8A60-8A6Z Whole blood 8.37E-01 -4.59E-02 -1.01E-01
Sensitive skin EK0Z Skin 8.50E-01 0.00E+00 0.00E+00
Sepsis with septic shock 1G41 Whole blood 4.90E-07 -2.41E-01 -4.11E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.19E-02 5.58E-01 1.12E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.85E-01 -3.27E-02 -1.60E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.85E-01 1.86E-01 1.07E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.85E-01 -2.90E-02 -2.43E-01
Skin cancer 2C30-2C3Z Skin 2.80E-02 1.39E-01 2.81E-01
Thrombocythemia 3B63 Whole blood 9.47E-02 1.66E-01 8.78E-01
Thrombocytopenia 3B64 Whole blood 4.17E-01 1.26E-02 4.31E-02
Thyroid cancer 2D10 Thyroid 7.07E-01 -3.30E-04 -1.61E-03
Tibial muscular dystrophy 8C75 Muscle tissue 7.52E-01 -5.03E-02 -1.36E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.83E-01 -4.99E-02 -1.35E-01
Type 2 diabetes 5A11 Liver tissue 9.08E-01 7.57E-02 4.40E-01
Ureter cancer 2C92 Urothelium 8.03E-01 -1.45E-02 -1.14E-01
Uterine cancer 2C78 Endometrium tissue 7.04E-03 -1.02E-01 -2.69E-01
Vitiligo ED63.0 Skin 2.29E-01 2.06E-03 7.67E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase. Cell Mol Life Sci. 2009 Aug;66(16):2743-57.