Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8R7QY)
| DME Name | Nitroreductase (NTR) | ||||
|---|---|---|---|---|---|
| Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; DHA2_15307 | ||||
| Gene Name | NTR | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| EC Number | EC: 1.5.1.39 | ||||
| Lineage | Species: Giardia intestinalis | ||||
| Tissue Distribution | Primarily distributed in human vagina. | ||||
| Sequence |
MPPICDAILRRRAIKQYTKESVSIEAIEYLRKVAVAIPTGHNTRHTEFAFVTNPRIIKTI
SQAKGEKAEYMQHAKLLIVVMGIQNDGVTSIATDMSIAAAMIQLACSDFGLACSWEQFYG RKNVYGEDSERIVLDVLRLLNSPNRRVLCALAIGYPAVQMPPADMHENGRIYMIE |
||||
| Function | This enzyme uses NADH as source of reducing equivalents to reduce of a variety of nitroaromatic compounds. | ||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
