Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8RIZD)

DME Name Collagen galactosyltransferase (COLGALT2)
Synonyms
Collagen beta(1-O)galactosyltransferase 2; Glycosyltransferase 25 family member 2; Hydroxylysine galactosyltransferase 2; Procollagen galactosyltransferase 2; C1orf17; COLGALT2; ColGalT 2; GLT25D2; KIAA0584
Gene Name COLGALT2
UniProt ID
GT252_HUMAN
INTEDE ID
DME0559
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23127
EC Number EC: 2.4.1.50
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.50
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAARPAATLAWSLLLLSSALLREGCRARFVAERDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRP
MDEPESYPDEIGPKHWPTSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYVQIREWKRTGCFPVPMVHSTFL
IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPHQ
TLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVANLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAEYKE
YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR
IYSNAKNTEALPPPTSLDTVPSRDEL
Function This enzyme transfers beta-galactose to hydroxylysine residues of collagen.
KEGG Pathway
Lysine degradation (hsa00310 )
Metabolic pathways (hsa01100 )
Other types of O-glycan biosynthesis (hsa00514 )
Reactome Pathway
Collagen biosynthesis and modifying enzymes (R-HSA-1650814 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Uridine Diphosphate Galactose DMPA0BJ Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Uridine Diphosphate Galactose Discovery agent [N.A.] Investigative Km = 0.01877 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.28E-06 -1.46E-01 -8.80E-01
Alopecia ED70 Skin from scalp 2.53E-03 1.85E-01 6.90E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.17E-02 1.14E-01 2.91E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.18E-02 -6.73E-02 -6.72E-01
Aortic stenosis BB70 Calcified aortic valve 2.98E-01 -3.89E-01 -5.02E-01
Apnea 7A40 Hyperplastic tonsil 5.75E-02 1.85E-01 8.69E-01
Arthropathy FA00-FA5Z Peripheral blood 6.51E-01 -9.14E-03 -2.97E-02
Asthma CA23 Nasal and bronchial airway 2.87E-01 7.60E-02 1.43E-01
Atopic dermatitis EA80 Skin 2.34E-02 1.28E-01 1.09E+00
Autism 6A02 Whole blood 2.07E-01 -1.43E-01 -6.15E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.08E-01 -2.05E-02 -1.08E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.86E-01 8.65E-02 9.38E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.29E-02 -1.19E-01 -4.38E-01
Batten disease 5C56.1 Whole blood 7.34E-01 8.13E-02 1.94E-01
Behcet's disease 4A62 Peripheral blood 8.83E-01 -5.56E-02 -1.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.62E-01 2.28E-02 1.06E-01
Bladder cancer 2C94 Bladder tissue 2.12E-02 -4.64E-01 -1.47E+00
Breast cancer 2C60-2C6Z Breast tissue 8.44E-59 -3.58E-01 -1.49E+00
Cardioembolic stroke 8B11.20 Whole blood 1.21E-01 2.33E-01 5.73E-01
Cervical cancer 2C77 Cervical tissue 1.97E-01 -6.60E-02 -3.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.71E-03 -1.24E-01 -5.75E-01
Chronic hepatitis C 1E51.1 Whole blood 5.08E-01 6.36E-02 1.16E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.55E-01 -7.25E-02 -2.83E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.16E-01 1.26E-02 5.96E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.60E-01 -1.53E-01 -6.22E-01
Colon cancer 2B90 Colon tissue 3.81E-12 9.22E-02 4.38E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.04E-01 1.26E-01 2.64E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.40E-01 -1.37E-01 -4.54E-01
Endometriosis GA10 Endometrium tissue 1.37E-01 3.71E-02 1.80E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.02E-01 -8.48E-02 -5.81E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.40E-06 -3.33E-01 -1.25E+00
Gastric cancer 2B72 Gastric tissue 7.93E-01 -1.07E-01 -2.13E-01
Glioblastopma 2A00.00 Nervous tissue 1.17E-32 -3.76E-01 -7.55E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.51E-01 -1.52E+00 -2.81E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.08E-02 -8.86E-01 -1.20E+00
Head and neck cancer 2D42 Head and neck tissue 2.20E-05 -1.51E-01 -6.21E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.37E-01 5.13E-01 5.60E-01
Huntington's disease 8A01.10 Whole blood 2.48E-01 -1.89E-01 -8.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.21E-01 -2.97E-01 -7.68E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.01E-01 -3.31E-02 -5.24E-01
Influenza 1E30 Whole blood 2.80E-02 -1.10E-01 -3.33E+00
Interstitial cystitis GC00.3 Bladder tissue 2.68E-04 -6.27E-01 -4.15E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.13E-04 -2.38E-01 -7.81E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.51E-01 -1.99E-02 -6.34E-02
Ischemic stroke 8B11 Peripheral blood 9.50E-01 6.22E-02 1.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.15E-01 -1.94E-02 -3.47E-02
Lateral sclerosis 8B60.4 Skin 4.48E-01 7.78E-02 9.51E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.15E-01 1.72E-01 2.97E-01
Liver cancer 2C12.0 Liver tissue 7.57E-01 -4.60E-02 -2.41E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.96E-01 1.21E-02 1.24E-01
Lung cancer 2C25 Lung tissue 9.81E-44 -6.33E-01 -1.87E+00
Lupus erythematosus 4A40 Whole blood 2.97E-01 -1.06E-01 -2.82E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.19E-01 -4.90E-04 -2.39E-03
Major depressive disorder 6A70-6A7Z Whole blood 4.30E-01 6.27E-02 1.41E-01
Melanoma 2C30 Skin 2.32E-02 4.02E-01 5.84E-01
Multiple myeloma 2A83.1 Peripheral blood 8.64E-01 1.47E-01 3.57E-01
Multiple myeloma 2A83.1 Bone marrow 2.59E-02 -1.31E-01 -1.18E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.36E-01 5.94E-02 2.88E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.81E-01 -8.73E-03 -3.48E-02
Myelofibrosis 2A20.2 Whole blood 3.57E-01 3.42E-02 2.72E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.84E-01 8.17E-04 1.34E-03
Myopathy 8C70.6 Muscle tissue 7.95E-01 3.45E-03 1.50E-02
Neonatal sepsis KA60 Whole blood 1.98E-06 -1.61E-01 -6.10E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.94E-08 -1.01E+00 -3.24E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.23E-01 -4.00E-03 -4.17E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.29E-01 9.11E-02 6.06E-01
Olive pollen allergy CA08.00 Peripheral blood 1.07E-01 -1.46E-01 -1.02E+00
Oral cancer 2B6E Oral tissue 1.14E-02 -2.64E-01 -8.35E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.48E-01 -1.27E-01 -2.13E-01
Osteoporosis FB83.1 Bone marrow 5.68E-03 4.32E-01 2.51E+00
Ovarian cancer 2C73 Ovarian tissue 4.72E-04 -4.98E-01 -2.16E+00
Pancreatic cancer 2C10 Pancreas 4.06E-02 -3.18E-01 -1.26E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.44E-01 1.02E-02 2.08E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.09E-03 -1.28E-01 -1.08E+00
Pituitary cancer 2D12 Pituitary tissue 1.75E-06 1.13E+00 2.58E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.07E-05 1.31E+00 3.10E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.52E-02 1.06E-01 8.91E-01
Polycythemia vera 2A20.4 Whole blood 5.02E-02 4.97E-02 3.38E-01
Pompe disease 5C51.3 Biceps muscle 2.06E-04 -9.79E-01 -4.76E+00
Preterm birth KA21.4Z Myometrium 2.57E-01 -8.75E-02 -3.59E-01
Prostate cancer 2C82 Prostate 2.20E-03 9.79E-01 1.30E+00
Psoriasis EA90 Skin 1.97E-01 5.23E-02 1.36E-01
Rectal cancer 2B92 Rectal colon tissue 4.69E-02 -2.24E-01 -1.36E+00
Renal cancer 2C90-2C91 Kidney 6.95E-02 -4.44E-02 -2.50E-01
Retinoblastoma 2D02.2 Uvea 2.61E-03 -4.62E-01 -1.76E+00
Rheumatoid arthritis FA20 Synovial tissue 4.05E-03 -8.68E-01 -1.83E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.67E-01 -1.71E-02 -1.02E-01
Schizophrenia 6A20 Prefrontal cortex 1.40E-01 -4.52E-02 -4.82E-02
Schizophrenia 6A20 Superior temporal cortex 2.63E-01 -1.63E-01 -6.26E-01
Scleroderma 4A42.Z Whole blood 1.21E-01 1.37E-01 4.74E-01
Seizure 8A60-8A6Z Whole blood 4.85E-01 -1.74E-01 -7.58E-01
Sensitive skin EK0Z Skin 3.35E-01 -3.07E-01 -2.37E+00
Sepsis with septic shock 1G41 Whole blood 1.53E-13 -1.34E-01 -4.65E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.12E-01 3.33E-01 1.44E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.51E-01 8.08E-02 5.83E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.70E-01 1.20E-01 4.09E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.94E-01 -6.06E-02 -9.04E-01
Skin cancer 2C30-2C3Z Skin 1.17E-41 1.04E+00 2.12E+00
Thrombocythemia 3B63 Whole blood 4.73E-01 5.89E-02 4.59E-01
Thrombocytopenia 3B64 Whole blood 4.63E-01 1.68E-02 2.23E-02
Thyroid cancer 2D10 Thyroid 3.37E-05 1.91E-01 5.73E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.45E-01 1.33E-02 3.38E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.32E-01 1.72E-01 6.99E-01
Type 2 diabetes 5A11 Liver tissue 1.55E-01 -7.77E-02 -1.09E+00
Ureter cancer 2C92 Urothelium 6.66E-01 -3.17E-04 -1.48E-03
Uterine cancer 2C78 Endometrium tissue 9.03E-04 -1.40E-01 -6.18E-01
Vitiligo ED63.0 Skin 1.26E-01 -1.42E-01 -5.83E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Core glycosylation of collagen is initiated by two beta(1-O)galactosyltransferases. Mol Cell Biol. 2009 Feb;29(4):943-52.