Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE9P5K7)

DME Name GDP-D-glucose phosphorylase 1 (GDPGP1)
Synonyms Nucleotidyltransferase GDPGP1; GDP-glucose phosphorylase 1; GDP-D-glucosephosphorylase 1; GDPGP1; C15orf58
Gene Name GDPGP1
UniProt ID
GDPP1_HUMAN
INTEDE ID
DME0469
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
390637
EC Number EC: 2.7.7.78
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.78
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALPHDSNETSYLLPPNNEDWGRQTIPDFVYGQKDLMAEGIQWPRNAPGIPDALPQSPFD
AALCSAWKQRVELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFD
PVQFNFNKIRPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHVLLVPEPARQLPQR
LLPGALRAGIEAVLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDP
GGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHEIAHNLFVTRGAPPGKT
SPSSALTGVRVILWARKSSFGIKDGEAFNVALCELAGHLPVKTSQDFSSLTEAAAVALIQ
DCRLPPSQAEDVQAALVALMSQEEQ
Function This enzyme has specific and highly efficient GDP-D-glucose phosphorylase regulating the levels of GDP-D-glucose in cells.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phosphate DMUXQG7 Constipation DD91.1 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
GDP-alpha-D-glucose DMF6MUB N. A. N. A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Phosphate Constipation [DD91.1] Approved Km = 2.9 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.53E-01 -9.45E-03 -5.65E-02
Alopecia ED70 Skin from scalp 1.05E-02 2.89E-01 4.78E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.56E-03 -5.63E-02 -3.33E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.21E-01 -8.34E-02 -4.96E-01
Aortic stenosis BB70 Calcified aortic valve 9.94E-01 6.32E-02 1.48E-01
Apnea 7A40 Hyperplastic tonsil 2.64E-01 -6.10E-02 -6.27E-01
Arthropathy FA00-FA5Z Peripheral blood 7.75E-01 -5.67E-02 -3.48E-01
Asthma CA23 Nasal and bronchial airway 1.90E-05 2.36E-01 3.46E-01
Atopic dermatitis EA80 Skin 1.08E-01 8.71E-02 5.77E-01
Autism 6A02 Whole blood 1.91E-01 -5.31E-02 -2.27E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.47E-01 -7.12E-02 -7.70E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.28E-02 1.16E-01 8.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.98E-07 1.33E-01 7.85E-01
Batten disease 5C56.1 Whole blood 3.74E-01 -9.56E-02 -6.63E-01
Behcet's disease 4A62 Peripheral blood 7.79E-01 -9.50E-02 -4.10E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.41E-01 -1.18E-02 -6.02E-02
Bladder cancer 2C94 Bladder tissue 4.09E-02 1.03E-01 7.81E-01
Breast cancer 2C60-2C6Z Breast tissue 4.37E-03 1.27E-02 4.68E-02
Cardioembolic stroke 8B11.20 Whole blood 8.31E-01 1.15E-01 1.97E-01
Cervical cancer 2C77 Cervical tissue 5.44E-01 3.28E-02 1.88E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.09E-01 -6.27E-02 -4.66E-01
Chronic hepatitis C 1E51.1 Whole blood 1.43E-01 9.87E-03 8.24E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.45E-01 5.63E-02 2.95E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.32E-01 -4.40E-02 -2.06E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.03E-01 4.44E-02 2.82E-01
Colon cancer 2B90 Colon tissue 1.18E-07 -1.33E-01 -5.68E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.05E-02 2.69E-01 1.23E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.47E-01 -6.09E-02 -3.50E-01
Endometriosis GA10 Endometrium tissue 3.41E-01 -2.61E-02 -1.18E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.53E-01 5.13E-02 2.37E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.91E-01 2.77E-02 1.93E-01
Gastric cancer 2B72 Gastric tissue 2.34E-01 1.05E-01 4.34E-01
Glioblastopma 2A00.00 Nervous tissue 1.28E-08 -1.15E-01 -3.94E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.75E-01 -3.20E-01 -1.28E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.06E-03 3.64E-01 1.37E+00
Head and neck cancer 2D42 Head and neck tissue 8.01E-10 -1.67E-01 -6.11E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.33E-02 -9.68E-02 -5.21E-01
Huntington's disease 8A01.10 Whole blood 8.85E-01 -3.26E-02 -5.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.60E-01 9.22E-02 8.06E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.28E-02 1.08E-01 5.88E-01
Influenza 1E30 Whole blood 3.74E-02 2.20E-01 2.33E+00
Interstitial cystitis GC00.3 Bladder tissue 1.81E-01 9.38E-02 6.93E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.32E-01 -9.84E-02 -2.95E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.32E-02 -1.84E-01 -4.47E-01
Ischemic stroke 8B11 Peripheral blood 2.73E-01 -1.70E-02 -7.85E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.14E-05 -3.96E-01 -7.42E-01
Lateral sclerosis 8B60.4 Skin 8.24E-01 1.20E-03 9.67E-03
Lateral sclerosis 8B60.4 Cervical spinal cord 9.89E-02 1.04E-01 5.58E-01
Liver cancer 2C12.0 Liver tissue 4.81E-01 1.92E-02 6.98E-02
Liver failure DB99.7-DB99.8 Liver tissue 2.79E-01 8.17E-02 5.40E-01
Lung cancer 2C25 Lung tissue 6.63E-27 1.42E-01 7.77E-01
Lupus erythematosus 4A40 Whole blood 1.93E-01 -2.07E-02 -5.63E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.27E-01 -2.29E-02 -1.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.83E-02 -2.82E-01 -5.07E-01
Melanoma 2C30 Skin 5.59E-01 4.80E-02 6.74E-02
Multiple myeloma 2A83.1 Peripheral blood 8.15E-01 -5.38E-02 -2.33E-01
Multiple myeloma 2A83.1 Bone marrow 4.82E-03 -2.11E-01 -1.77E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.90E-01 -1.41E-01 -2.90E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.58E-02 1.51E-01 7.84E-01
Myelofibrosis 2A20.2 Whole blood 9.74E-01 4.50E-02 3.85E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.64E-03 -1.84E-01 -2.14E-01
Myopathy 8C70.6 Muscle tissue 2.87E-02 3.92E-02 3.69E-01
Neonatal sepsis KA60 Whole blood 1.12E-01 -4.53E-02 -2.49E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.62E-02 -2.12E-01 -5.29E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.37E-01 7.13E-03 3.59E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.94E-02 -1.33E-01 -1.03E+00
Olive pollen allergy CA08.00 Peripheral blood 4.71E-01 9.43E-02 4.56E-01
Oral cancer 2B6E Oral tissue 1.38E-01 -8.95E-02 -3.83E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.19E-01 -5.72E-03 -3.12E-02
Osteoporosis FB83.1 Bone marrow 1.06E-01 -2.43E-01 -1.10E+00
Ovarian cancer 2C73 Ovarian tissue 6.30E-01 1.64E-02 5.78E-02
Pancreatic cancer 2C10 Pancreas 8.69E-01 -1.66E-02 -5.66E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.49E-01 6.45E-02 4.96E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.76E-01 -4.12E-02 -3.69E-01
Pituitary cancer 2D12 Pituitary tissue 6.92E-01 -1.65E-01 -5.00E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.45E-01 1.04E-01 4.04E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.81E-01 -1.17E-01 -6.17E-01
Polycythemia vera 2A20.4 Whole blood 1.50E-01 -1.31E-02 -1.07E-01
Pompe disease 5C51.3 Biceps muscle 2.00E-01 8.00E-02 3.91E-01
Preterm birth KA21.4Z Myometrium 5.03E-02 4.72E-02 6.73E-01
Prostate cancer 2C82 Prostate 1.23E-02 5.59E-01 7.90E-01
Psoriasis EA90 Skin 2.10E-01 -2.87E-02 -1.13E-01
Rectal cancer 2B92 Rectal colon tissue 5.87E-01 -1.20E-01 -5.70E-01
Renal cancer 2C90-2C91 Kidney 1.40E-01 -1.37E-01 -4.43E-01
Retinoblastoma 2D02.2 Uvea 7.59E-02 1.12E-01 1.32E+00
Rheumatoid arthritis FA20 Synovial tissue 2.76E-01 -2.06E-01 -6.37E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.60E-02 2.78E-02 2.16E-01
Schizophrenia 6A20 Prefrontal cortex 1.50E-02 -1.73E-02 -7.29E-02
Schizophrenia 6A20 Superior temporal cortex 9.25E-01 -2.23E-02 -2.11E-01
Scleroderma 4A42.Z Whole blood 1.42E-01 -1.15E-01 -5.59E-01
Seizure 8A60-8A6Z Whole blood 6.22E-01 4.78E-02 2.49E-01
Sensitive skin EK0Z Skin 9.61E-01 2.46E-02 1.27E-01
Sepsis with septic shock 1G41 Whole blood 1.18E-04 -4.15E-02 -2.19E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.35E-02 9.54E-02 4.06E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.28E-01 6.57E-02 4.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.61E-01 -2.43E-01 -1.33E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.47E-02 1.39E-01 1.04E+00
Skin cancer 2C30-2C3Z Skin 7.35E-10 2.32E-01 7.43E-01
Thrombocythemia 3B63 Whole blood 6.00E-02 2.40E-03 1.90E-02
Thrombocytopenia 3B64 Whole blood 6.24E-01 8.84E-02 1.30E-01
Thyroid cancer 2D10 Thyroid 3.98E-07 -1.30E-01 -3.69E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.67E-04 2.32E-01 1.46E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.65E-01 -1.67E-01 -1.35E+00
Type 2 diabetes 5A11 Liver tissue 3.11E-01 3.95E-02 2.31E-01
Ureter cancer 2C92 Urothelium 5.04E-01 7.02E-03 5.61E-02
Uterine cancer 2C78 Endometrium tissue 1.08E-07 -2.00E-01 -4.58E-01
Vitiligo ED63.0 Skin 6.05E-02 -3.09E-01 -6.39E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 A novel GDP-D-glucose phosphorylase involved in quality control of the nucleoside diphosphate sugar pool in Caenorhabditis elegans and mammals. J Biol Chem. 2011 Jun 17;286(24):21511-23.