Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEA742Z)
DME Name | Cysteinyl-conjugate N-acetyltransferase (NAT8) | ||||
---|---|---|---|---|---|
Synonyms | Acetyltransferase 2; Camello-like protein 1; GLA; N-acetyltransferase 8; ATase2; CCNAT; CML1; NAT8; TSC501 | ||||
Gene Name | NAT8 | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 2.3.1.80 | ||||
Lineage |
Species: Homo sapiens |
||||
Sequence |
MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW
LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL |
||||
Function |
This enzyme acetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids. This is the final step in a major route for detoxification of a wide variety of reactive electrophiles which starts with their incorporation into glutathione S-conjugates. The glutathione S-conjugates are then further processed into cysteine S-conjugates and finally mercapturic acids which are water soluble and can be readily excreted in urine or bile. Alternatively, it may have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
Experimental Enzyme Kinetic Data of Drugs |
|
|||||||||||||||||||||||||||