Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DECFU6W)

DME Name Xylulose kinase (XYLB)
Synonyms Xylulokinase; Xylulo-phosphorylating enzyme; 1-deoxy-D-xylulokinase; ATP/polyphosphate xylulokinase; D-xylulokinase; XYLB
Gene Name XYLB
UniProt ID
XYLB_HUMAN
INTEDE ID
DME0526
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9942
EC Number EC: 2.7.1.17
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE
Function This enzyme phosphorylates D-xylulose to produce D-xylulose 5-phosphate, a molecule that may play an important role in the regulation of glucose metabolism and lipogenesis.
KEGG Pathway
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Reactome Pathway
Formation of xylulose-5-phosphate (R-HSA-5661270 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-xylulose DM1ROU7 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.20E-02 3.09E-02 2.32E-01
Alopecia ED70 Skin from scalp 1.10E-02 1.22E-01 3.17E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.14E-03 -4.75E-02 -4.00E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.27E-02 -2.99E-02 -3.85E-01
Aortic stenosis BB70 Calcified aortic valve 7.01E-01 2.94E-02 1.70E-01
Apnea 7A40 Hyperplastic tonsil 4.20E-02 -2.94E-01 -2.39E+00
Arthropathy FA00-FA5Z Peripheral blood 8.46E-02 7.59E-02 1.02E+00
Asthma CA23 Nasal and bronchial airway 7.75E-01 3.38E-02 6.28E-02
Atopic dermatitis EA80 Skin 4.54E-03 -8.01E-02 -8.84E-01
Autism 6A02 Whole blood 6.46E-01 -2.90E-02 -2.02E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.18E-02 -1.49E-01 -2.01E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.31E-01 -8.64E-02 -8.05E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.99E-03 -5.02E-02 -3.76E-01
Batten disease 5C56.1 Whole blood 3.76E-01 -1.16E-01 -1.46E+00
Behcet's disease 4A62 Peripheral blood 1.91E-01 2.85E-02 1.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.17E-01 -2.08E-02 -1.88E-01
Bladder cancer 2C94 Bladder tissue 6.37E-04 4.57E-01 2.38E+00
Breast cancer 2C60-2C6Z Breast tissue 2.25E-14 5.59E-02 3.65E-01
Cardioembolic stroke 8B11.20 Whole blood 4.89E-05 -1.67E-01 -1.14E+00
Cervical cancer 2C77 Cervical tissue 8.19E-02 3.09E-02 1.75E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.83E-01 -3.16E-03 -2.30E-02
Chronic hepatitis C 1E51.1 Whole blood 9.22E-01 -2.63E-02 -2.21E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.36E-01 -1.20E-03 -1.10E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.01E-01 -3.97E-03 -3.46E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.54E-01 8.63E-02 7.35E-01
Colon cancer 2B90 Colon tissue 9.96E-01 1.33E-02 8.27E-02
Coronary artery disease BA80-BA8Z Peripheral blood 1.27E-01 -1.66E-01 -6.78E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.14E-01 -6.03E-02 -8.42E-01
Endometriosis GA10 Endometrium tissue 6.01E-02 -4.95E-02 -3.62E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.65E-01 3.76E-02 4.90E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.77E-01 -5.63E-02 -3.90E-01
Gastric cancer 2B72 Gastric tissue 2.59E-01 1.20E-01 6.62E-01
Glioblastopma 2A00.00 Nervous tissue 1.27E-09 -5.72E-02 -3.59E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.54E-01 1.11E-02 8.57E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.64E-02 -1.37E-01 -4.90E-01
Head and neck cancer 2D42 Head and neck tissue 2.96E-01 -1.81E-02 -1.49E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.09E-01 1.29E-02 1.42E-01
Huntington's disease 8A01.10 Whole blood 2.87E-01 6.58E-02 7.32E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.82E-01 -8.57E-02 -6.66E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.26E-01 1.84E-02 2.01E-01
Influenza 1E30 Whole blood 3.07E-02 2.20E-01 2.68E+00
Interstitial cystitis GC00.3 Bladder tissue 1.13E-01 -1.23E-01 -9.13E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.58E-01 3.46E-02 3.72E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.60E-01 6.70E-02 2.64E-01
Ischemic stroke 8B11 Peripheral blood 8.51E-01 1.18E-02 8.87E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.56E-01 2.89E-02 1.28E-01
Lateral sclerosis 8B60.4 Skin 3.68E-01 6.21E-02 6.54E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.03E-01 3.04E-02 1.72E-01
Liver cancer 2C12.0 Liver tissue 5.25E-02 -2.69E-01 -6.18E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.37E-02 -1.39E-01 -8.28E-01
Lung cancer 2C25 Lung tissue 2.65E-15 9.30E-02 7.05E-01
Lupus erythematosus 4A40 Whole blood 4.27E-05 4.36E-02 2.83E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.48E-01 -1.24E-02 -1.11E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.12E-01 -4.22E-02 -2.08E-01
Melanoma 2C30 Skin 1.66E-01 -1.95E-01 -2.28E-01
Multiple myeloma 2A83.1 Peripheral blood 7.21E-02 9.81E-02 1.35E+00
Multiple myeloma 2A83.1 Bone marrow 5.06E-03 -1.49E-01 -1.41E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.15E-01 1.61E-01 5.96E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.66E-01 3.68E-02 2.74E-01
Myelofibrosis 2A20.2 Whole blood 6.73E-02 7.60E-02 8.28E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.34E-01 -1.80E-02 -3.69E-02
Myopathy 8C70.6 Muscle tissue 3.60E-01 2.44E-02 2.50E-01
Neonatal sepsis KA60 Whole blood 4.61E-01 -8.84E-03 -5.68E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.74E-02 -2.11E-01 -9.34E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.88E-01 3.39E-02 5.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.59E-02 5.30E-02 1.22E+00
Olive pollen allergy CA08.00 Peripheral blood 6.82E-03 9.48E-02 1.78E+00
Oral cancer 2B6E Oral tissue 3.67E-05 -2.11E-01 -1.07E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.50E-01 -5.53E-02 -2.56E-01
Osteoporosis FB83.1 Bone marrow 7.12E-02 1.26E-01 9.17E-01
Ovarian cancer 2C73 Ovarian tissue 9.13E-01 -4.80E-02 -3.68E-01
Pancreatic cancer 2C10 Pancreas 6.79E-01 -4.58E-02 -2.47E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.27E-01 -3.05E-02 -2.41E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.11E-01 2.44E-02 1.83E-01
Pituitary cancer 2D12 Pituitary tissue 7.20E-01 -5.53E-02 -4.08E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.82E-01 -6.54E-02 -5.88E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.52E-01 -3.33E-02 -4.33E-01
Polycythemia vera 2A20.4 Whole blood 7.82E-06 1.13E-01 1.14E+00
Pompe disease 5C51.3 Biceps muscle 9.40E-01 -4.66E-02 -6.81E-01
Preterm birth KA21.4Z Myometrium 6.23E-01 -1.01E-01 -5.10E-01
Prostate cancer 2C82 Prostate 1.07E-10 1.05E+00 2.31E+00
Psoriasis EA90 Skin 1.41E-11 1.80E-01 7.20E-01
Rectal cancer 2B92 Rectal colon tissue 7.10E-02 -2.33E-01 -8.42E-01
Renal cancer 2C90-2C91 Kidney 1.69E-01 -8.56E-02 -3.24E-01
Retinoblastoma 2D02.2 Uvea 3.14E-01 -1.04E-01 -1.67E+00
Rheumatoid arthritis FA20 Synovial tissue 3.19E-01 -5.50E-02 -1.95E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.41E-01 1.30E-02 1.66E-01
Schizophrenia 6A20 Prefrontal cortex 8.53E-01 1.75E-04 1.17E-03
Schizophrenia 6A20 Superior temporal cortex 5.99E-01 8.21E-03 1.08E-01
Scleroderma 4A42.Z Whole blood 2.48E-01 -6.28E-02 -4.71E-01
Seizure 8A60-8A6Z Whole blood 3.73E-01 -8.98E-03 -1.06E-01
Sensitive skin EK0Z Skin 9.58E-01 -5.77E-02 -2.47E-01
Sepsis with septic shock 1G41 Whole blood 3.48E-01 6.55E-03 4.41E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.40E-01 1.12E-01 7.17E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.62E-01 7.82E-03 8.42E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.61E-01 1.36E-02 2.07E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.07E-01 -1.95E-02 -2.27E-01
Skin cancer 2C30-2C3Z Skin 1.56E-17 2.43E-01 6.08E-01
Thrombocythemia 3B63 Whole blood 2.60E-02 6.83E-02 6.79E-01
Thrombocytopenia 3B64 Whole blood 5.58E-01 6.39E-02 5.54E-01
Thyroid cancer 2D10 Thyroid 7.52E-03 3.09E-02 2.33E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.54E-01 -4.38E-02 -3.42E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.40E-01 -3.19E-02 -1.84E-01
Type 2 diabetes 5A11 Liver tissue 4.54E-02 2.23E-01 1.30E+00
Ureter cancer 2C92 Urothelium 7.49E-01 -5.73E-02 -4.22E-01
Uterine cancer 2C78 Endometrium tissue 1.92E-01 -2.07E-03 -1.15E-02
Vitiligo ED63.0 Skin 3.06E-01 -1.52E-02 -4.18E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Structure and function of human xylulokinase, an enzyme with important roles in carbohydrate metabolism. J Biol Chem. 2013 Jan 18;288(3):1643-52.