General Information of Drug-Metabolizing Enzyme (DME) (ID: DEDMWFX)

DME Name Keto-steroid reductase (HSD17B7)
Synonyms
Estradiol 17-beta-dehydrogenase 7; 17-beta-HSD 7; 17-beta-hydroxysteroid dehydrogenase 7; 3-keto-steroid reductase; Short chain dehydrogenase/reductase family 37C member 1; HSD17B7; SDR37C1; UNQ2563/PRO6243
Gene Name HSD17B7
UniProt ID
DHB7_HUMAN
INTEDE ID
DME0424
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51478
EC Number EC: 1.1.1.270
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.270
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIV
QVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTA
EGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFS
LEDFQHSKGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGILPPFIW
TLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQ
KMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
Function This enzyme is responsible for the reduction of the keto group on the C-3 of sterols.
KEGG Pathway
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Steroid biosynthesis (hsa00100 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Cholesterol biosynthesis (R-HSA-191273 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estrone DM5T6US Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.22E-01 2.55E-01 4.73E-01
Alopecia ED70 Skin from scalp 1.57E-01 6.26E-02 2.33E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.54E-09 3.28E-01 1.10E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 2.41E-01 -3.95E-03 -2.71E-02
Aortic stenosis BB70 Calcified aortic valve 8.44E-01 -1.81E-01 -1.69E-01
Apnea 7A40 Hyperplastic tonsil 3.48E-02 7.89E-01 3.11E+00
Arthropathy FA00-FA5Z Peripheral blood 4.62E-01 -1.01E-01 -7.98E-01
Asthma CA23 Nasal and bronchial airway 9.87E-05 -2.14E-01 -5.70E-01
Atopic dermatitis EA80 Skin 2.87E-07 2.60E-01 1.48E+00
Autism 6A02 Whole blood 4.19E-01 5.17E-02 2.21E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.03E-01 5.54E-01 2.76E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.25E-01 -3.56E-03 -1.44E-02
Bacterial infection of gingival 1C1H Gingival tissue 4.64E-05 -1.46E-01 -6.13E-01
Batten disease 5C56.1 Whole blood 2.56E-01 -1.57E-01 -8.47E-01
Behcet's disease 4A62 Peripheral blood 5.94E-01 9.86E-03 4.09E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.72E-02 1.38E-01 7.92E-01
Bladder cancer 2C94 Bladder tissue 5.75E-02 -4.38E-01 -1.37E+00
Breast cancer 2C60-2C6Z Breast tissue 7.07E-83 8.68E-01 1.94E+00
Cardioembolic stroke 8B11.20 Whole blood 4.62E-06 -3.55E-01 -1.31E+00
Cervical cancer 2C77 Cervical tissue 8.32E-01 -4.47E-03 -9.04E-03
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.06E-01 -7.34E-02 -3.05E-01
Chronic hepatitis C 1E51.1 Whole blood 1.50E-01 1.61E-01 8.30E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.02E-01 9.22E-02 2.81E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.88E-01 -1.88E-02 -6.39E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.26E-01 -1.87E-01 -8.85E-01
Colon cancer 2B90 Colon tissue 2.22E-40 6.06E-01 1.56E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.23E-01 -5.12E-03 -6.90E-03
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.17E-01 1.70E-02 6.72E-02
Endometriosis GA10 Endometrium tissue 6.04E-01 -4.09E-02 -9.49E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.55E-02 9.63E-02 4.73E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.53E-04 4.00E-01 1.42E+00
Gastric cancer 2B72 Gastric tissue 8.45E-01 8.81E-02 2.60E-01
Glioblastopma 2A00.00 Nervous tissue 7.15E-02 1.83E-02 3.28E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.66E-04 -7.91E-01 -8.72E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.76E-01 -2.91E-01 -3.62E-01
Head and neck cancer 2D42 Head and neck tissue 4.53E-16 -3.58E-01 -1.54E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.68E-01 2.71E-01 4.40E-01
Huntington's disease 8A01.10 Whole blood 6.07E-01 -9.14E-02 -3.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.77E-02 -3.58E-01 -1.05E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.37E-03 -1.84E-01 -1.23E+00
Influenza 1E30 Whole blood 1.79E-01 -1.14E-01 -4.11E-01
Interstitial cystitis GC00.3 Bladder tissue 7.35E-01 5.81E-02 8.95E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.72E-01 7.74E-02 2.17E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.12E-01 1.34E-01 3.56E-01
Ischemic stroke 8B11 Peripheral blood 6.83E-02 -7.23E-02 -2.29E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.56E-03 -7.59E-02 -2.19E-01
Lateral sclerosis 8B60.4 Skin 2.68E-01 2.49E-01 7.19E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.73E-01 5.39E-01 7.70E-01
Liver cancer 2C12.0 Liver tissue 4.24E-07 6.20E-01 1.08E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.00E-01 -6.16E-02 -8.47E-02
Lung cancer 2C25 Lung tissue 3.18E-05 2.13E-01 4.25E-01
Lupus erythematosus 4A40 Whole blood 7.37E-04 9.49E-02 2.41E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.14E-01 2.25E-02 1.27E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.09E-01 -2.86E-02 -6.31E-02
Melanoma 2C30 Skin 8.63E-03 -5.51E-01 -7.85E-01
Multiple myeloma 2A83.1 Peripheral blood 9.94E-02 -1.14E-01 -3.78E-01
Multiple myeloma 2A83.1 Bone marrow 9.79E-05 6.40E-01 2.76E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.13E-01 -1.66E-01 -4.75E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.77E-01 6.72E-02 2.10E-01
Myelofibrosis 2A20.2 Whole blood 2.70E-02 -2.33E-01 -1.29E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.40E-02 -2.79E-01 -4.67E-01
Myopathy 8C70.6 Muscle tissue 4.31E-01 -7.61E-02 -1.97E-01
Neonatal sepsis KA60 Whole blood 3.25E-06 -2.61E-01 -6.11E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.64E-07 -1.21E+00 -3.99E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.35E-01 4.93E-01 1.70E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.64E-01 -4.90E-01 -9.28E-01
Olive pollen allergy CA08.00 Peripheral blood 6.38E-02 -2.14E-01 -1.09E+00
Oral cancer 2B6E Oral tissue 3.55E-01 1.86E-01 2.82E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.69E-01 -3.13E-02 -8.41E-02
Osteoporosis FB83.1 Bone marrow 7.70E-02 -4.09E-01 -1.04E+00
Ovarian cancer 2C73 Ovarian tissue 1.93E-01 1.84E-02 2.71E-02
Pancreatic cancer 2C10 Pancreas 1.23E-01 6.02E-01 7.60E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.24E-01 6.02E-02 1.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.10E-02 -8.55E-02 -4.59E-01
Pituitary cancer 2D12 Pituitary tissue 6.61E-05 -5.52E-01 -2.22E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.67E-03 -6.55E-01 -2.31E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.00E-01 -6.37E-02 -3.95E-01
Polycythemia vera 2A20.4 Whole blood 3.06E-09 -3.27E-01 -1.41E+00
Pompe disease 5C51.3 Biceps muscle 2.95E-01 1.07E-01 4.16E-01
Preterm birth KA21.4Z Myometrium 7.45E-02 -3.39E-01 -8.19E-01
Prostate cancer 2C82 Prostate 1.07E-04 -5.72E-01 -1.18E+00
Psoriasis EA90 Skin 7.08E-01 1.32E-01 3.31E-01
Rectal cancer 2B92 Rectal colon tissue 3.20E-04 8.52E-01 3.29E+00
Renal cancer 2C90-2C91 Kidney 5.48E-04 6.04E-01 1.60E+00
Retinoblastoma 2D02.2 Uvea 2.82E-02 2.81E-01 1.15E+00
Rheumatoid arthritis FA20 Synovial tissue 1.16E-02 3.56E-01 1.15E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.91E-01 -4.02E-02 -2.51E-01
Schizophrenia 6A20 Prefrontal cortex 6.69E-02 5.75E-02 1.73E-01
Schizophrenia 6A20 Superior temporal cortex 4.76E-01 6.47E-02 2.74E-01
Scleroderma 4A42.Z Whole blood 1.42E-03 -1.60E-01 -1.29E+00
Seizure 8A60-8A6Z Whole blood 3.51E-01 2.16E-02 8.65E-02
Sensitive skin EK0Z Skin 9.23E-01 -1.15E-02 -8.86E-02
Sepsis with septic shock 1G41 Whole blood 1.04E-06 -1.26E-01 -3.01E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.44E-02 -3.48E-01 -1.23E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.46E-02 -4.20E-01 -7.67E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.55E-02 -2.73E-01 -1.77E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.83E-01 -2.07E-02 -6.00E-02
Skin cancer 2C30-2C3Z Skin 4.35E-01 7.18E-02 1.66E-01
Thrombocythemia 3B63 Whole blood 4.63E-02 -3.00E-01 -1.54E+00
Thrombocytopenia 3B64 Whole blood 8.91E-01 -1.72E-05 -4.38E-05
Thyroid cancer 2D10 Thyroid 2.33E-05 1.65E-01 4.94E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.34E-02 1.79E-01 6.39E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.00E-02 2.95E-01 1.55E+00
Type 2 diabetes 5A11 Liver tissue 1.21E-01 3.10E-01 1.30E+00
Ureter cancer 2C92 Urothelium 3.96E-01 9.04E-02 4.29E-01
Uterine cancer 2C78 Endometrium tissue 3.38E-04 2.09E-01 4.99E-01
Vitiligo ED63.0 Skin 6.23E-01 -4.63E-02 -2.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.