Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEISQ2)
DME Name | Azoreductase (azoR) | ||||
---|---|---|---|---|---|
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; EF_2601; azoA | ||||
Gene Name | azoR | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 1.7.1.6 | ||||
Lineage |
Species: Enterococcus faecalis |
||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLS
AWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTI NVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFI EGIDHFPDRAEELLNTAMTKATEYGKTF |
||||
Function |
This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. And it requires NADH, but not NADPH, as an electron donor for its activity. And it can also reduce a wide range of sulfonated azo dyes. The substrate preference order is methyl Red > Orange II > Ponceau BS > Ponceau S > Orange G > Amaranth.
|
||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||