Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGAZ8O)

DME Name Dimethylaniline oxidase 4 (FMO4)
Synonyms Dimethylaniline monooxygenase [N-oxide-forming] 4; FMO 4; FMO2; FMO4; Hepatic flavin-containing monooxygenase 4
Gene Name FMO4
UniProt ID
FMO4_HUMAN
INTEDE ID
DME0637
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2329
EC Number EC: 1.14.13.8
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS
ETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC
SFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
SVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKQVFPLNL
ERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLV
RDKLQDRMSPYLVSLWRG
Function This enzyme is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides.
KEGG Pathway
Drug metabolism - cytochrome P450 (hsa00982 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Benzydamine DMEQL9U Chemotherapy or radiotherapy-induced mucositis DA42-DA60 Discontinued in Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.21E-01 -1.27E-02 -5.11E-02
Alzheimer's disease 8A20 Entorhinal cortex 8.75E-03 1.04E-01 3.57E-01
Asthma CA23 Nasal and bronchial airway 7.95E-01 6.31E-03 7.57E-03
Behcet's disease 4A62 Peripheral blood 8.08E-01 -2.05E-02 -8.24E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.06E-01 1.05E-03 4.24E-03
Bladder cancer 2C94 Bladder tissue 8.58E-11 7.59E-01 6.95E+00
Breast cancer 2C60-2C6Z Breast tissue 5.63E-30 -4.59E-01 -1.07E+00
Colon cancer 2B90 Colon tissue 1.07E-73 -1.20E+00 -2.64E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.82E-01 -6.06E-02 -1.35E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.54E-01 -1.26E-01 -6.21E-01
Gastric cancer 2B72 Gastric tissue 1.26E-01 -8.60E-01 -1.59E+00
Glioblastopma 2A00.00 Nervous tissue 5.21E-14 3.53E-01 5.48E-01
Head and neck cancer 2D42 Head and neck tissue 2.56E-11 -5.42E-01 -6.69E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.49E-01 -1.61E-02 -4.12E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.99E-02 3.99E-01 1.20E+00
Interstitial cystitis GC00.3 Bladder tissue 2.94E-02 -1.32E-01 -1.71E+00
Ischemic stroke 8B11 Peripheral blood 4.11E-02 6.64E-02 4.29E-01
Liver cancer 2C12.0 Liver tissue 3.61E-08 -8.77E-01 -1.28E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.27E-05 -1.02E+00 -2.60E+00
Lung cancer 2C25 Lung tissue 4.80E-02 -9.64E-02 -2.85E-01
Lupus erythematosus 4A40 Whole blood 7.57E-01 6.83E-02 1.69E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.94E-01 -2.33E-02 -9.31E-02
Multiple myeloma 2A83.1 Bone marrow 1.35E-05 -1.04E+00 -3.65E+00
Multiple myeloma 2A83.1 Peripheral blood 1.26E-01 2.91E-01 1.29E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.51E-02 -2.59E-01 -1.43E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.26E-03 2.59E-01 6.63E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.50E-01 -1.30E-01 -1.70E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.78E-09 -1.74E+00 -5.27E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.31E-04 -5.64E-01 -2.42E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.35E-01 1.21E-01 1.92E-01
Olive pollen allergy CA08.00 Peripheral blood 3.98E-01 2.04E-01 4.76E-01
Oral cancer 2B6E Oral tissue 3.33E-02 2.55E-03 4.07E-03
Ovarian cancer 2C73 Ovarian tissue 6.78E-02 5.53E-02 2.50E-01
Pancreatic cancer 2C10 Pancreas 4.85E-01 -6.35E-02 -1.74E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.26E-01 7.09E-02 2.12E-01
Pituitary cancer 2D12 Pituitary tissue 1.38E-04 -8.23E-01 -1.81E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.69E-01 2.53E-02 7.30E-02
Pompe disease 5C51.3 Biceps muscle 1.17E-01 2.25E-01 1.13E+00
Prostate cancer 2C82 Prostate 1.95E-09 -6.84E-01 -1.57E+00
Psoriasis EA90 Skin 2.68E-02 -1.64E-01 -4.69E-01
Rectal cancer 2B92 Rectal colon tissue 4.43E-05 -9.56E-01 -3.87E+00
Renal cancer 2C90-2C91 Kidney 3.45E-03 -7.44E-01 -7.66E-01
Retinoblastoma 2D02.2 Uvea 3.02E-05 1.29E+00 5.35E+00
Schizophrenia 6A20 Prefrontal cortex 1.99E-01 3.50E-01 5.52E-01
Schizophrenia 6A20 Superior temporal cortex 4.31E-01 -6.82E-02 -3.06E-01
Scleroderma 4A42.Z Whole blood 9.24E-02 -1.40E-01 -6.36E-01
Seizure 8A60-8A6Z Whole blood 5.22E-01 1.03E-01 3.62E-01
Sepsis with septic shock 1G41 Whole blood 1.40E-06 -1.24E-01 -4.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.29E-01 1.11E-01 7.83E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.91E-01 -4.10E-01 -6.16E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.66E-03 4.59E-01 3.05E+00
Skin cancer 2C30-2C3Z Skin 1.99E-03 3.74E-01 7.66E-01
Thrombocythemia 3B63 Whole blood 2.09E-05 1.39E-01 1.26E+00
Thrombocytopenia 3B64 Whole blood 2.61E-01 -1.39E-01 -2.13E-01
Thyroid cancer 2D10 Thyroid 9.22E-19 -4.28E-01 -1.42E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.52E-10 7.45E-01 3.75E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.84E-02 6.51E-01 3.78E+00
Type 2 diabetes 5A11 Liver tissue 6.16E-01 -3.78E-01 -9.37E-01
Ureter cancer 2C92 Urothelium 6.92E-02 -1.23E-01 -5.16E-01
Uterine cancer 2C78 Endometrium tissue 5.68E-03 3.14E-01 5.19E-01
Vitiligo ED63.0 Skin 8.97E-02 -1.69E-01 -3.30E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 In vitro evaluation of potential in vivo probes for human flavin-containing monooxygenase (FMO): metabolism of benzydamine and caffeine by FMO and P450 isoforms. Br J Clin Pharmacol. 2000 Oct;50(4):311-4.