Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIPST6)
| DME Name | Cytochrome P450 147G1 (cyp147) | ||||
|---|---|---|---|---|---|
| Synonyms | Cytochrome P450 family 147 subfamily G member 1; P450 147G1; MMAR_2930; P450 147G1; cyp147G1 | ||||
| Gene Name | cyp147G1 | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| EC Number | EC: 1.14.15.28 | ||||
| Lineage | Species: Mycobacterium marinum | ||||
| Tissue Distribution | Primarily distributed in human skin. | ||||
| Sequence |
MNAETAWAEAMKFENRPNPYPYFDELRKTPVAKVAEKTYVVTGYRELLALAHDPRISSDI
TRSPSGFGGEAPQPEPGSEHVQAYGQDASIIVSDPPDHDRARRQVMRHFAPPHSPDLIPS MEPFVVRLANDLLNQASARGSTRLDVVEDFAYPIPVAVICKILGVPIEDEPKFHAWIFDF MAGTDLGPEGDTEEGQVLAEKGRVSTAALTDYLGDLVRSYAKTPGEGLLSKLLHDDGPDG PMSVPETTANALLLLVAGHDSTVNTITNCVMTLLRNPGSWDLVRQRPELIPRTIEEVQRL QSAVQFFPSRSATDEIEIGGTVIPAGSAVHLIYAAANRDPRRFDNPNRFDPLREDNEHFG WGSGIHTCMGGPLARLEVNLAVEIFLRRVQSPKLVVDPPPYRHNQIFRGPRHLWVDFAAI TE |
||||
| Function |
This enzyme catalyzes the selective hydroxylation of linear and -2 methyl branched fatty acids at the -1 position. Substrates of Cytochrome P450 147G1 include fatty acids ranging from octanoic to hexadecanoic acid.
|
||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
