Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJ1LMB)

DME Name Pyroglutamase (OPLAH)
Synonyms Thyrotropin-releasing factor pyroglutamate; 5-OPase; 5-oxo-L-prolinase; 5-oxoprolinase; OPLAH
Gene Name OPLAH
UniProt ID
OPLA_HUMAN
INTEDE ID
DME0560
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
26873
EC Number EC: 3.5.2.9
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amide hydrolase
EC: 3.5.2.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAG
MLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFD
LAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGALRGKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSAT
TYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYA
PETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
RSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVD
KMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICIS
VGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEV
FGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRA
FRPYGLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPQALAFPEHGSVYEYRRAQEAV
Function This enzyme catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.
KEGG Pathway
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glutathione synthesis and recycling (R-HSA-174403 )
Defective OPLAH causes 5-oxoprolinase deficiency (OPLAHD) (R-HSA-5578998 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Procysteine DMF9RB4 Amyotrophic lateral sclerosis 8B60.0 Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.34E-09 -3.28E-01 -7.15E-01
Alopecia ED70 Skin from scalp 4.96E-02 1.25E-01 2.92E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.98E-02 1.41E-01 3.95E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.44E-01 4.40E-03 2.55E-02
Aortic stenosis BB70 Calcified aortic valve 1.78E-01 2.82E-01 5.34E-01
Apnea 7A40 Hyperplastic tonsil 1.67E-01 -5.84E-01 -1.78E+00
Arthropathy FA00-FA5Z Peripheral blood 9.44E-01 -2.12E-01 -5.71E-01
Asthma CA23 Nasal and bronchial airway 5.48E-01 8.05E-02 1.27E-01
Atopic dermatitis EA80 Skin 1.47E-13 9.59E-01 3.08E+00
Autism 6A02 Whole blood 6.69E-01 -5.37E-02 -2.29E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.13E-02 6.11E-01 1.58E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.50E-04 1.21E+00 2.69E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.25E-03 -1.67E-01 -4.61E-01
Batten disease 5C56.1 Whole blood 7.55E-01 6.74E-02 2.87E-01
Behcet's disease 4A62 Peripheral blood 8.42E-01 1.27E-02 4.85E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.04E-01 7.43E-03 2.99E-02
Bladder cancer 2C94 Bladder tissue 5.04E-01 -7.76E-02 -1.94E-01
Breast cancer 2C60-2C6Z Breast tissue 3.09E-18 4.27E-01 6.25E-01
Cardioembolic stroke 8B11.20 Whole blood 5.95E-09 5.26E-01 1.97E+00
Cervical cancer 2C77 Cervical tissue 2.23E-03 -8.58E-01 -1.28E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.15E-01 1.62E-01 2.41E-01
Chronic hepatitis C 1E51.1 Whole blood 3.83E-01 6.34E-02 2.30E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.73E-01 -1.85E-01 -5.87E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.97E-01 7.82E-02 1.79E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.83E-02 1.31E-01 1.93E+00
Colon cancer 2B90 Colon tissue 8.34E-02 -8.98E-02 -2.28E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.46E-01 9.50E-03 6.44E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.26E-01 -2.17E-01 -6.85E-01
Endometriosis GA10 Endometrium tissue 5.20E-04 -3.68E-01 -1.18E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.58E-01 8.75E-02 3.89E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.30E-02 2.63E-01 1.09E+00
Gastric cancer 2B72 Gastric tissue 4.69E-01 2.13E-01 2.01E-01
Glioblastopma 2A00.00 Nervous tissue 1.45E-14 -3.25E-01 -6.84E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.61E-01 -9.37E-01 -8.78E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.95E-03 -4.91E-01 -1.21E+00
Head and neck cancer 2D42 Head and neck tissue 1.49E-05 -2.63E-01 -4.15E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.47E-01 1.83E-01 4.43E-01
Huntington's disease 8A01.10 Whole blood 7.42E-01 9.93E-03 4.09E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.40E-01 -2.87E-01 -8.33E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.05E-01 2.54E-02 2.42E-01
Influenza 1E30 Whole blood 1.08E-01 1.23E-01 9.74E-01
Interstitial cystitis GC00.3 Bladder tissue 9.95E-02 -1.74E-01 -8.54E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.22E-03 9.73E-01 1.83E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.35E-01 -8.75E-03 -3.00E-02
Ischemic stroke 8B11 Peripheral blood 3.29E-01 -1.49E-01 -5.36E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.01E-04 1.36E-01 3.39E-01
Lateral sclerosis 8B60.4 Skin 1.07E-01 -3.10E-01 -1.05E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.12E-01 -2.41E-02 -6.31E-02
Liver cancer 2C12.0 Liver tissue 1.58E-01 -1.59E-01 -2.89E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.46E-04 -1.15E+00 -2.11E+00
Lung cancer 2C25 Lung tissue 3.59E-86 8.26E-01 2.31E+00
Lupus erythematosus 4A40 Whole blood 2.56E-02 1.84E-02 3.46E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.36E-02 -1.42E-01 -5.45E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.18E-01 -1.85E-02 -5.49E-02
Melanoma 2C30 Skin 6.66E-07 -9.46E-01 -1.63E+00
Multiple myeloma 2A83.1 Peripheral blood 2.16E-01 -1.02E-01 -4.37E-01
Multiple myeloma 2A83.1 Bone marrow 7.61E-02 2.55E-01 6.67E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.38E-01 -9.66E-02 -2.49E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.78E-03 6.96E-02 3.30E-01
Myelofibrosis 2A20.2 Whole blood 9.82E-02 4.28E-01 2.02E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.89E-02 2.94E-01 4.92E-01
Myopathy 8C70.6 Muscle tissue 4.99E-03 -4.15E-01 -1.62E+00
Neonatal sepsis KA60 Whole blood 5.07E-32 1.12E+00 3.07E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.94E-03 -5.19E-01 -1.72E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.87E-01 -2.15E-01 -3.61E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.67E-01 -1.61E-01 -4.70E-01
Olive pollen allergy CA08.00 Peripheral blood 1.18E-03 6.14E-01 3.35E+00
Oral cancer 2B6E Oral tissue 4.59E-04 -5.11E-01 -7.95E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.49E-01 -4.96E-01 -4.67E-01
Osteoporosis FB83.1 Bone marrow 4.71E-02 7.16E-01 2.55E+00
Ovarian cancer 2C73 Ovarian tissue 2.19E-07 1.45E+00 4.46E+00
Pancreatic cancer 2C10 Pancreas 2.90E-03 2.92E-01 7.37E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.30E-01 -1.62E-01 -5.20E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.92E-03 2.19E-01 9.61E-01
Pituitary cancer 2D12 Pituitary tissue 4.01E-02 3.92E-01 1.31E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.58E-02 6.46E-01 1.82E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.17E-01 -1.35E-01 -5.57E-01
Polycythemia vera 2A20.4 Whole blood 3.74E-14 4.03E-01 1.94E+00
Pompe disease 5C51.3 Biceps muscle 5.76E-02 2.15E-01 6.96E-01
Preterm birth KA21.4Z Myometrium 9.33E-01 3.61E-02 6.83E-02
Prostate cancer 2C82 Prostate 8.13E-01 -2.10E-01 -3.20E-01
Psoriasis EA90 Skin 2.11E-01 -8.00E-02 -1.44E-01
Rectal cancer 2B92 Rectal colon tissue 6.36E-01 1.16E-02 3.78E-02
Renal cancer 2C90-2C91 Kidney 7.96E-02 -5.09E-01 -7.28E-01
Retinoblastoma 2D02.2 Uvea 6.56E-08 2.42E+00 9.13E+00
Rheumatoid arthritis FA20 Synovial tissue 6.64E-01 2.37E-01 3.83E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.08E-01 7.07E-02 2.72E-01
Schizophrenia 6A20 Prefrontal cortex 1.31E-01 -3.05E-02 -1.14E-01
Schizophrenia 6A20 Superior temporal cortex 4.87E-01 -3.26E-02 -1.75E-01
Scleroderma 4A42.Z Whole blood 8.93E-06 4.22E-01 2.41E+00
Seizure 8A60-8A6Z Whole blood 9.87E-01 1.89E-02 6.84E-02
Sensitive skin EK0Z Skin 5.57E-01 1.22E-02 4.36E-02
Sepsis with septic shock 1G41 Whole blood 7.32E-166 1.70E+00 4.65E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.61E-01 -3.47E-02 -1.44E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.74E-02 2.27E-01 7.34E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.40E-01 2.27E-01 6.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.98E-01 -4.29E-03 -9.88E-03
Skin cancer 2C30-2C3Z Skin 1.09E-41 -9.54E-01 -1.89E+00
Thrombocythemia 3B63 Whole blood 1.56E-02 8.89E-02 4.18E-01
Thrombocytopenia 3B64 Whole blood 7.69E-01 0.00E+00 0.00E+00
Thyroid cancer 2D10 Thyroid 6.97E-06 -2.82E-01 -8.37E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-02 -7.95E-01 -1.06E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.76E-02 3.98E-01 1.74E+00
Type 2 diabetes 5A11 Liver tissue 1.16E-01 -5.00E-01 -7.02E-01
Ureter cancer 2C92 Urothelium 2.06E-01 -6.17E-04 -3.13E-03
Uterine cancer 2C78 Endometrium tissue 2.33E-08 -4.72E-01 -4.63E-01
Vitiligo ED63.0 Skin 3.86E-01 -7.83E-02 -5.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Increased expression of the MGMT repair protein mediated by cysteine prodrugs and chemopreventative natural products in human lymphocytes and tumor cell lines. Carcinogenesis. 2007 Feb;28(2):378-89.