Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOCWU3)

DME Name Alcohol dehydrogenase class-II (ADH4)
Synonyms Alcohol dehydrogenase 4; Alcohol dehydrogenase class II pi chain; All-trans-retinol dehydrogenase [NAD(+)] ADH4; ADH4
Gene Name ADH4
UniProt ID
ADH4_HUMAN
INTEDE ID
DME0130
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
127
EC Number EC: 1.1.1.105
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.105
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG
LAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLK
SPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGC
GFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKA
LGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDK
ISEAFDLMNQGKSVRTILIF
Function
This enzyme catalyzes the NAD-dependent oxidation of either all-trans- retinol or 9-cis-retinol.It also oxidizes long chain omega-hydroxy fatty acids, such as 20-HETE, producing both the intermediate aldehyde, 20-oxoarachidonate and the end product, a dicarboxylic acid, (5Z,8Z,11Z,14Z)-eicosatetraenedioate. Besides, it can also catalyzes the reduction of benzoquinones.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Fatty acid degradation (hsa00071 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
RA biosynthesis pathway (R-HSA-5365859 )
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethanol DMDRQZU Chronic pain MG30 Approved [1]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ANDROSTERONE DMITJAK N. A. N. A. Phase 3 [2]
7 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
acetaldehyde DMJFKG4 Discovery agent N.A. Investigative [1]
BRN-2330710 DM87VP6 N. A. N. A. Investigative [1]
Hydroxymethylpyrene DMPGAR2 N. A. N. A. Investigative [1]
Octanal DMTN0OK N. A. N. A. Investigative [1]
octanol DMBGHPE Discovery agent N.A. Investigative [1]
Pyrene-1-aldehyde DMEF6IP N. A. N. A. Investigative [1]
Pyrenemethanol DMGJ0RM N. A. N. A. Investigative [1]
⏷ Show the Full List of 7 Investigative Drug(s)
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
acetaldehyde Discovery agent [N.A.] Investigative Km = 0.34 microM [1]
octanol Discovery agent [N.A.] Investigative Km = 0.39 microM [1]
Ethanol Chronic pain [MG30] Approved Km = 0.77 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.38E-01 8.45E-03 7.23E-02
Alopecia ED70 Skin from scalp 3.36E-01 1.07E-01 3.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.42E-01 2.39E-03 2.48E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.92E-01 7.38E-02 6.14E-01
Aortic stenosis BB70 Calcified aortic valve 8.11E-01 5.67E-02 1.27E-01
Apnea 7A40 Hyperplastic tonsil 5.63E-01 3.41E-02 3.66E-01
Arthropathy FA00-FA5Z Peripheral blood 8.55E-01 -2.60E-03 -2.86E-02
Asthma CA23 Nasal and bronchial airway 9.27E-01 -3.25E-02 -4.54E-02
Atopic dermatitis EA80 Skin 9.97E-02 2.00E-02 2.38E-01
Autism 6A02 Whole blood 9.17E-01 -3.31E-02 -2.06E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.41E-01 -9.81E-02 -1.52E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.47E-01 4.32E-03 4.32E-02
Bacterial infection of gingival 1C1H Gingival tissue 3.92E-01 1.02E-02 1.02E-01
Batten disease 5C56.1 Whole blood 3.99E-01 4.27E-02 7.27E-01
Behcet's disease 4A62 Peripheral blood 9.29E-01 2.56E-03 3.15E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.42E-01 1.22E-02 1.41E-01
Bladder cancer 2C94 Bladder tissue 4.46E-02 1.64E-01 7.90E-01
Breast cancer 2C60-2C6Z Breast tissue 6.80E-15 -1.12E-01 -3.63E-01
Cardioembolic stroke 8B11.20 Whole blood 5.31E-01 -1.73E-02 -7.97E-02
Cervical cancer 2C77 Cervical tissue 1.25E-01 -6.56E-02 -4.08E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.91E-01 -4.10E-02 -3.46E-01
Chronic hepatitis C 1E51.1 Whole blood 8.64E-01 -4.57E-03 -7.05E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 6.47E-01 1.16E-02 1.10E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.19E-01 2.75E-02 2.37E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.21E-01 -1.23E-02 -1.59E-01
Colon cancer 2B90 Colon tissue 9.21E-03 -8.77E-03 -4.24E-02
Coronary artery disease BA80-BA8Z Peripheral blood 8.52E-01 -5.62E-02 -3.85E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.09E-01 -3.44E-02 -2.14E-01
Endometriosis GA10 Endometrium tissue 6.71E-01 -2.05E-03 -1.57E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.47E-01 2.88E-02 6.50E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.00E-02 -1.02E-01 -7.84E-01
Gastric cancer 2B72 Gastric tissue 4.29E-02 2.62E-01 1.05E+00
Glioblastopma 2A00.00 Nervous tissue 2.19E-11 -5.00E-02 -3.72E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.44E-01 -7.21E-02 -1.57E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.52E-02 -1.53E-01 -8.74E-01
Head and neck cancer 2D42 Head and neck tissue 1.31E-02 -1.14E-02 -5.25E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.42E-01 -3.28E-02 -2.61E-01
Huntington's disease 8A01.10 Whole blood 4.44E-01 2.28E-03 3.00E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.19E-01 4.45E-02 3.86E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.81E-01 6.18E-02 1.02E+00
Influenza 1E30 Whole blood 1.76E-01 6.28E-02 1.12E+00
Interstitial cystitis GC00.3 Bladder tissue 1.54E-01 5.19E-02 4.29E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.42E-01 -3.90E-02 -2.72E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.91E-01 5.16E-02 1.84E-01
Ischemic stroke 8B11 Peripheral blood 6.33E-01 1.03E-02 1.24E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.20E-01 -3.12E-03 -2.13E-02
Lateral sclerosis 8B60.4 Skin 1.70E-02 -9.50E-02 -1.72E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.00E-01 8.52E-02 7.06E-01
Liver cancer 2C12.0 Liver tissue 1.24E-23 -2.11E+00 -2.48E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.41E-03 -2.28E+00 -4.46E+00
Lung cancer 2C25 Lung tissue 8.39E-01 -2.05E-02 -1.59E-01
Lupus erythematosus 4A40 Whole blood 2.04E-05 5.77E-02 2.85E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.58E-02 6.71E-02 9.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.28E-02 9.31E-03 6.04E-02
Melanoma 2C30 Skin 5.04E-01 -1.26E-01 -2.57E-01
Multiple myeloma 2A83.1 Peripheral blood 5.70E-01 -1.23E-02 -9.79E-02
Multiple myeloma 2A83.1 Bone marrow 2.93E-01 -5.29E-02 -7.99E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.78E-01 -1.02E-01 -4.75E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.74E-01 -3.83E-03 -4.14E-02
Myelofibrosis 2A20.2 Whole blood 6.37E-02 1.15E-01 1.39E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.05E-01 7.84E-03 1.10E-02
Myopathy 8C70.6 Muscle tissue 5.19E-02 -4.97E-02 -8.20E-01
Neonatal sepsis KA60 Whole blood 4.56E-01 -9.14E-03 -6.37E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.83E-01 -9.36E-02 -4.69E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.62E-02 4.51E-01 1.01E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.88E-01 7.99E-04 7.10E-03
Olive pollen allergy CA08.00 Peripheral blood 1.58E-01 5.57E-02 6.55E-01
Oral cancer 2B6E Oral tissue 1.79E-02 -6.57E-02 -3.64E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.06E-01 -4.45E-02 -2.66E-01
Osteoporosis FB83.1 Bone marrow 8.59E-03 3.38E-01 5.01E+00
Ovarian cancer 2C73 Ovarian tissue 5.04E-01 -9.14E-02 -1.14E+00
Pancreatic cancer 2C10 Pancreas 4.25E-03 1.26E-02 6.95E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 6.67E-01 -5.82E-02 -6.69E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.49E-01 -4.92E-02 -6.49E-01
Pituitary cancer 2D12 Pituitary tissue 1.64E-01 5.14E-02 7.49E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.66E-01 8.32E-04 1.34E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.94E-01 -8.94E-03 -1.16E-01
Polycythemia vera 2A20.4 Whole blood 2.61E-06 5.18E-02 6.83E-01
Pompe disease 5C51.3 Biceps muscle 3.44E-01 -8.52E-03 -1.04E-01
Preterm birth KA21.4Z Myometrium 4.42E-01 -1.03E-02 -1.39E-01
Prostate cancer 2C82 Prostate 4.65E-02 1.79E-01 5.15E-01
Psoriasis EA90 Skin 1.38E-05 9.80E-02 4.77E-01
Rectal cancer 2B92 Rectal colon tissue 9.48E-01 3.10E-02 9.12E-02
Renal cancer 2C90-2C91 Kidney 5.50E-01 -5.81E-02 -4.88E-01
Retinoblastoma 2D02.2 Uvea 9.04E-03 -1.16E-01 -1.60E+00
Rheumatoid arthritis FA20 Synovial tissue 5.64E-03 -3.14E-01 -2.40E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.92E-01 -1.61E-02 -1.72E-01
Schizophrenia 6A20 Prefrontal cortex 7.47E-01 6.66E-03 4.91E-02
Schizophrenia 6A20 Superior temporal cortex 2.83E-01 -4.73E-02 -5.44E-01
Scleroderma 4A42.Z Whole blood 1.53E-09 1.64E-01 4.26E+00
Seizure 8A60-8A6Z Whole blood 6.42E-01 2.87E-03 2.70E-02
Sensitive skin EK0Z Skin 9.89E-02 -2.35E-01 -1.09E+00
Sepsis with septic shock 1G41 Whole blood 4.57E-02 -7.31E-03 -4.22E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.38E-01 -8.55E-02 -5.12E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.98E-02 5.92E-02 4.03E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.10E-01 1.00E-01 1.71E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.67E-02 5.51E-02 5.21E-01
Skin cancer 2C30-2C3Z Skin 5.24E-01 6.69E-03 2.57E-02
Thrombocythemia 3B63 Whole blood 9.03E-02 3.79E-02 5.02E-01
Thrombocytopenia 3B64 Whole blood 6.24E-01 5.58E-03 4.97E-02
Thyroid cancer 2D10 Thyroid 1.22E-04 7.21E-02 6.04E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.25E-03 -1.23E-01 -7.62E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.28E-01 2.50E-01 1.67E+00
Type 2 diabetes 5A11 Liver tissue 5.77E-01 -5.89E-02 -1.71E-01
Ureter cancer 2C92 Urothelium 5.29E-01 9.16E-03 6.46E-02
Uterine cancer 2C78 Endometrium tissue 2.57E-03 -8.79E-02 -5.88E-01
Vitiligo ED63.0 Skin 8.18E-01 5.16E-02 2.05E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Oxidation of alcohols and reduction of aldehydes derived from methyl- and dimethylpyrenes by cDNA-expressed human alcohol dehydrogenases. Toxicology. 2008 Mar 12;245(1-2):65-75.
2 13-cis-retinoic acid competitively inhibits 3 alpha-hydroxysteroid oxidation by retinol dehydrogenase RoDH-4: a mechanism for its anti-androgenic effects in sebaceous glands? Biochem Biophys Res Commun. 2003 Mar 28;303(1):273-8.