Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOWDK1)
| DME Name | Oxygen-insensitive NADPH nitroreductase B (nfsB) | ||||
|---|---|---|---|---|---|
| Synonyms | Oxygen-insensitive NAD(P)H nitroreductase B; Dihydropteridine reductase; FMN-dependent nitroreductase; STM0578; pnrB | ||||
| Gene Name | nfsB | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| 3D Structure | |||||
| Gene ID | |||||
| EC Number | EC: 1.5.1.34 | ||||
| Lineage | Species: Salmonella enterica | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MDIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEDADGRFATPEAKAANDKG RRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGFDAEVLDAEFGLKE KGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV |
||||
| Function |
This enzyme can reduce a variety of nitroaromatic compounds using NADH (and to lesser extent NADPH) as source of reducing equivalents; two electrons are transferred. And it also can reduce nitrofurazone.
|
||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||
|
3 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||
References
