Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DETH24K)

DME Name Red cell/liver pyruvate kinase (PKLR)
Synonyms Pyruvate kinase PKLR; R-type/L-type pyruvate kinase; Pyruvate kinase isozymes L/R; Pyruvate kinase 1; PK1; PKL; PKLR
Gene Name PKLR
UniProt ID
KPYR_HUMAN
INTEDE ID
DME0497
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5313
EC Number EC: 2.7.1.40
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.40
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
Function This enzyme plays a key role in glycolysis.
KEGG Pathway
Biosynthesis of amino acids (hsa01230 )
Carbon metabolism (hsa01200 )
Glycolysis / Gluconeogenesis (hsa00010 )
Insulin signaling pathway (hsa04910 )
Maturity onset diabetes of the young (hsa04950 )
Metabolic pathways (hsa01100 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Purine metabolism (hsa00230 )
Pyruvate metabolism (hsa00620 )
Type II diabetes mellitus (hsa04930 )
Reactome Pathway
Glycolysis (R-HSA-70171 )
Regulation of gene expression in beta cells [P30613-2] (R-HSA-210745 )
ChREBP activates metabolic gene expression [P30613-1] (R-HSA-163765 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phosphoenolpyruvate DM2D947 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Phosphoenolpyruvate Discovery agent [N.A.] Investigative Km = 0.112 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.63E-37 -1.31E+00 -1.87E+00
Alopecia ED70 Skin from scalp 7.28E-02 2.28E-01 3.20E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.39E-03 -4.35E-02 -2.47E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.82E-01 -8.82E-02 -7.14E-01
Aortic stenosis BB70 Calcified aortic valve 7.34E-01 -2.84E-01 -5.33E-01
Apnea 7A40 Hyperplastic tonsil 3.19E-01 -3.50E-01 -1.01E+00
Arthropathy FA00-FA5Z Peripheral blood 9.55E-01 -5.71E-02 -3.90E-01
Asthma CA23 Nasal and bronchial airway 4.03E-02 -1.13E-01 -3.15E-01
Atopic dermatitis EA80 Skin 6.40E-01 -8.45E-02 -4.75E-01
Autism 6A02 Whole blood 7.15E-01 2.48E-02 1.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.35E-03 -1.75E-01 -8.86E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.06E-01 -9.23E-03 -7.22E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.67E-02 7.05E-02 3.26E-01
Batten disease 5C56.1 Whole blood 4.63E-01 1.04E-01 1.18E+00
Behcet's disease 4A62 Peripheral blood 5.19E-01 3.03E-02 1.55E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.72E-01 4.22E-03 2.28E-02
Bladder cancer 2C94 Bladder tissue 1.16E-04 9.93E-01 3.24E+00
Breast cancer 2C60-2C6Z Breast tissue 6.20E-04 -8.16E-02 -2.36E-01
Cardioembolic stroke 8B11.20 Whole blood 5.35E-04 1.19E-01 8.43E-01
Cervical cancer 2C77 Cervical tissue 5.96E-01 -6.85E-02 -5.13E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.09E-01 -7.93E-03 -2.47E-02
Chronic hepatitis C 1E51.1 Whole blood 3.22E-01 4.70E-02 2.89E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.13E-01 9.26E-02 3.35E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.23E-03 9.85E-02 4.65E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.21E-01 -4.09E-02 -2.44E-01
Colon cancer 2B90 Colon tissue 1.42E-05 -1.70E-01 -5.00E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.32E-01 -9.67E-02 -1.48E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.13E-01 1.87E-02 1.17E-01
Endometriosis GA10 Endometrium tissue 3.96E-01 1.09E-01 4.36E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.80E-01 -4.19E-02 -2.00E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.68E-05 -2.62E-01 -8.54E-01
Gastric cancer 2B72 Gastric tissue 1.68E-01 -4.59E-01 -1.90E+00
Glioblastopma 2A00.00 Nervous tissue 3.05E-02 -7.87E-02 -2.57E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.39E-01 -6.05E-02 -7.70E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.10E-04 -5.78E-01 -2.26E+00
Head and neck cancer 2D42 Head and neck tissue 8.59E-02 2.61E-02 1.07E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.84E-01 -2.81E-02 -2.35E-01
Huntington's disease 8A01.10 Whole blood 1.99E-01 3.24E-02 4.95E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.88E-01 5.58E-02 4.07E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.71E-01 2.24E-02 2.37E-01
Influenza 1E30 Whole blood 7.30E-01 -3.61E-02 -1.33E-01
Interstitial cystitis GC00.3 Bladder tissue 1.99E-01 6.97E-02 6.70E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.12E-01 -9.52E-03 -2.82E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.60E-01 4.21E-02 1.49E-01
Ischemic stroke 8B11 Peripheral blood 3.79E-01 6.16E-02 4.16E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.65E-01 1.45E-04 7.25E-04
Lateral sclerosis 8B60.4 Skin 9.66E-01 9.96E-02 4.61E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.74E-01 5.68E-02 2.03E-01
Liver cancer 2C12.0 Liver tissue 4.09E-01 -3.11E-01 -2.86E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.80E-02 -4.85E-01 -1.23E+00
Lung cancer 2C25 Lung tissue 2.80E-05 -7.18E-02 -3.15E-01
Lupus erythematosus 4A40 Whole blood 2.07E-02 -1.65E-01 -2.80E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.63E-01 5.55E-02 3.10E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.95E-01 -2.38E-02 -1.00E-01
Melanoma 2C30 Skin 1.83E-04 -9.65E-01 -7.22E-01
Multiple myeloma 2A83.1 Peripheral blood 8.43E-01 -5.29E-02 -2.05E-01
Multiple myeloma 2A83.1 Bone marrow 3.85E-04 -6.34E-01 -2.09E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.86E-01 -6.25E-02 -2.03E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.33E-02 4.21E-02 1.40E-01
Myelofibrosis 2A20.2 Whole blood 6.96E-03 2.22E-01 1.16E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.23E-01 1.72E-01 2.97E-01
Myopathy 8C70.6 Muscle tissue 1.04E-01 -1.82E-01 -7.56E-01
Neonatal sepsis KA60 Whole blood 6.65E-04 -2.10E-01 -6.99E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.71E-02 -4.80E-01 -9.42E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.11E-02 8.57E-01 1.37E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.70E-01 -1.07E-02 -5.99E-02
Olive pollen allergy CA08.00 Peripheral blood 4.59E-01 1.11E-01 7.95E-01
Oral cancer 2B6E Oral tissue 5.79E-06 -5.16E-01 -1.27E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.07E-02 -1.97E-01 -8.47E-01
Osteoporosis FB83.1 Bone marrow 3.22E-01 2.08E-01 8.50E-01
Ovarian cancer 2C73 Ovarian tissue 7.09E-01 -8.57E-02 -2.08E-01
Pancreatic cancer 2C10 Pancreas 1.26E-02 -2.57E-01 -6.57E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.43E-01 -6.15E-02 -2.78E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.62E-01 3.67E-02 2.45E-01
Pituitary cancer 2D12 Pituitary tissue 1.06E-01 1.40E-01 4.17E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.09E-02 2.43E-01 1.27E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.45E-01 -3.38E-02 -2.01E-01
Polycythemia vera 2A20.4 Whole blood 1.23E-01 5.29E-02 2.87E-01
Pompe disease 5C51.3 Biceps muscle 4.15E-01 -6.44E-02 -3.64E-01
Preterm birth KA21.4Z Myometrium 7.05E-01 1.97E-01 6.27E-01
Prostate cancer 2C82 Prostate 1.48E-03 -5.04E-01 -9.63E-01
Psoriasis EA90 Skin 3.41E-08 -2.96E-01 -6.73E-01
Rectal cancer 2B92 Rectal colon tissue 5.13E-01 -8.51E-02 -6.01E-01
Renal cancer 2C90-2C91 Kidney 2.95E-02 -1.08E+00 -1.45E+00
Retinoblastoma 2D02.2 Uvea 9.68E-06 -3.80E-01 -2.61E+00
Rheumatoid arthritis FA20 Synovial tissue 9.32E-01 9.89E-03 2.70E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.33E-01 -5.39E-03 -4.31E-02
Schizophrenia 6A20 Prefrontal cortex 5.41E-01 3.84E-03 1.24E-02
Schizophrenia 6A20 Superior temporal cortex 8.25E-01 -2.30E-02 -1.64E-01
Scleroderma 4A42.Z Whole blood 4.07E-01 5.58E-02 3.88E-01
Seizure 8A60-8A6Z Whole blood 3.60E-01 -7.44E-02 -3.01E-01
Sensitive skin EK0Z Skin 7.61E-01 -2.53E-01 -6.89E-01
Sepsis with septic shock 1G41 Whole blood 4.34E-01 -1.16E-02 -3.65E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.58E-01 1.34E-01 3.17E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.74E-01 1.01E-01 5.15E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.86E-01 -1.86E-02 -2.72E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.53E-02 -3.01E-01 -2.03E+00
Skin cancer 2C30-2C3Z Skin 1.10E-08 -3.11E-01 -5.06E-01
Thrombocythemia 3B63 Whole blood 2.70E-01 -6.46E-03 -3.44E-02
Thrombocytopenia 3B64 Whole blood 7.24E-01 -1.75E-02 -6.42E-02
Thyroid cancer 2D10 Thyroid 2.82E-01 -3.73E-02 -1.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.43E-05 -1.87E-01 -1.35E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.37E-01 3.33E-02 1.73E-01
Type 2 diabetes 5A11 Liver tissue 1.58E-01 2.22E-01 7.47E-01
Ureter cancer 2C92 Urothelium 9.20E-01 -2.08E-03 -9.92E-03
Uterine cancer 2C78 Endometrium tissue 9.88E-01 1.39E-02 4.64E-02
Vitiligo ED63.0 Skin 4.70E-01 -2.30E-02 -2.88E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Energetic coupling between an oxidizable cysteine and the phosphorylatable N-terminus of human liver pyruvate kinase. Biochemistry. 2013 Jan 22;52(3):466-76.