Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEX5D46)

DME Name	Oxygen-insensitive NADPH nitroreductase A (nfsA)
Synonyms	Oxygen-insensitive NAD(P)H nitroreductase A; Modulator of drug activity A; STM0874; mdaA; nfsA; pnrA; snrA
Gene Name	nfsA
UniProt ID	NFSA_SALTY
INTEDE ID	DME1971
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	1252393
EC Number	EC: 1.5.1.38 Oxidoreductase CH-NH donor oxidoreductase NAD/NADP acceptor oxidoreductase EC: 1.5.1.38
Lineage	Species: Salmonella enterica Kingdom: Bacteria Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Salmonella Species: Salmonella enterica Subspecies: Salmonella enterica subsp. enterica serovar Typhimurium Subspecies: Salmonella enterica subsp. enterica serovar Typhimurium TA100
Tissue Distribution	Primarily distributed in human gut.
Sequence	MSPTIELLCGHRSIRHFTDEPVTDAQREAIIAAARSTSSSSFLQCSSIIRITDRALREAL VPLTGGQKHVAQAAEFWVFCADFNRHLQICPDAQLGLAEQLLLGVVDTAMMGQNALTAAE SLGLGGVYIGGIRNNIESVTELLKLPKHVLPLFGLCLGWPADNPDLKPRLPAELVVHENQ YQPLDEKLLARYDEQLAEYYLTRGSNTRRDTWSDHIRRTLIKENRPFILEYLHKQGWATR
Function	This enzyme catalyzes the reduction of nitroaromatic compounds using NADPH, and has a broad electron acceptor specificity. Moreover, it reduces nitrofurazone by a ping-pong bi-bi mechanism possibly to generate a two-electron transfer product.
KEGG Pathway	Microbial metabolism in diverse environments (stm01120 ) Nitrotoluene degradation (stm00633 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DME

2 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nitrazepam	DMEGIQ6	Epilepsy	8A60-8A68	Approved	[1]
Ornidazole	DM6QHDJ	Amoebiasis	1A36	Approved	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AI3-23606	DMHMT49	N. A.	N. A.	Phase 1	[2]
------------------------------------------------------------------------------------

3 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-chloro-5-nitro-N-phenylbenzamide	DMUGQIV	Discovery agent	N.A.	Investigative	[3]
CL-205086	DMB6XUY	N. A.	N. A.	Investigative	[2]
Nitroimidazole	DMMY2S5	Trypanosomiasis	1D51-1F53	Investigative	[2]
------------------------------------------------------------------------------------

References

1	Identification and characterization of SnrA, an inducible oxygen-insensitive nitroreductase in Salmonella enterica serovar Typhimurium TA1535. Mutat Res. 2002 Oct 31;508(1-2):59-70.
2	Delamanid is not metabolized by Salmonella or human nitroreductases: a possible mechanism for the lack of mutagenicity. Regul Toxicol Pharmacol. 2017 Mar;84:1-8.
3	Effects of bacterial and presystemic nitroreductase metabolism of 2-chloro-5-nitro-N-phenylbenzamide on its mutagenicity and bioavailability. Chem Biol Interact. 2012 Apr 15;197(1):16-22.