Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEZBN53)

DME Name Sulfotransferase 2B1 (SULT2B1)
Synonyms Sulfotransferase family cytosolic 2B member 1; Alcohol sulfotransferase; Hydroxysteroid sulfotransferase 2; Sulfotransferase family 2B member 1; HSST2; ST2B1; SULT2B1
Gene Name SULT2B1
UniProt ID
ST2B1_HUMAN
INTEDE ID
DME0384
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6820
EC Number EC: 2.8.2.2
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRD
DDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPR
LMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFL
KGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSV
VAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ
MRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETP
HPRPS
Function
This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation. It is also responsible for the sulfation of cholesterol. It can catalyze sulfation of the 3beta-hydroxyl groups of steroids, such as, pregnenolone and dehydroepiandrosterone (DHEA). And it preferentially sulfonates cholesterol, while it has also significant activity with pregnenolone and DHEA. Besides, it plays a role in epidermal cholesterol metabolism.
KEGG Pathway
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [1]
Pregnenolone DM6VFO1 Schizophrenia 6A20 Phase 4 [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Pregnenolone Schizophrenia [6A20] Phase 4 Km = 0.0018 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.59E-02 5.96E-02 2.56E-01
Alopecia ED70 Skin from scalp 7.18E-01 -2.89E-03 -8.49E-03
Alzheimer's disease 8A20 Entorhinal cortex 5.52E-02 4.27E-02 2.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.13E-01 -4.91E-02 -4.86E-01
Aortic stenosis BB70 Calcified aortic valve 7.57E-01 -4.65E-02 -1.52E-01
Apnea 7A40 Hyperplastic tonsil 4.82E-01 -2.58E-01 -5.99E-01
Arthropathy FA00-FA5Z Peripheral blood 6.31E-01 5.15E-02 3.00E-01
Asthma CA23 Nasal and bronchial airway 4.14E-03 1.62E-01 3.10E-01
Atopic dermatitis EA80 Skin 2.05E-02 -4.49E-01 -1.85E+00
Autism 6A02 Whole blood 4.32E-01 9.89E-02 3.64E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.19E-02 -1.81E-01 -1.19E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.50E-01 0.00E+00 0.00E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.63E-05 -2.99E-01 -6.08E-01
Batten disease 5C56.1 Whole blood 2.94E-01 1.14E-01 9.33E-01
Behcet's disease 4A62 Peripheral blood 2.62E-02 -1.95E-01 -9.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.00E-01 -1.47E-02 -7.59E-02
Bladder cancer 2C94 Bladder tissue 7.37E-05 2.14E-01 1.27E+00
Breast cancer 2C60-2C6Z Breast tissue 3.11E-11 1.70E-01 3.68E-01
Cardioembolic stroke 8B11.20 Whole blood 7.11E-01 5.57E-02 2.09E-01
Cervical cancer 2C77 Cervical tissue 7.28E-05 -1.68E+00 -1.35E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.63E-01 9.43E-03 3.72E-02
Chronic hepatitis C 1E51.1 Whole blood 3.54E-01 -2.51E-02 -1.52E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.32E-01 -6.85E-02 -1.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.09E-02 -1.82E-01 -3.76E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.99E-03 -8.89E-01 -1.27E+00
Colon cancer 2B90 Colon tissue 6.62E-63 7.62E-01 2.03E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.06E-02 -3.05E-01 -2.23E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.04E-01 4.02E-02 1.81E-01
Endometriosis GA10 Endometrium tissue 3.60E-03 -2.55E-01 -7.00E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.65E-01 1.74E-02 1.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.59E-01 2.02E-02 8.83E-02
Gastric cancer 2B72 Gastric tissue 8.60E-02 2.55E-01 8.13E-01
Glioblastopma 2A00.00 Nervous tissue 7.14E-63 -3.70E-01 -1.26E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.41E-01 -2.95E-02 -3.23E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.35E-02 -3.37E-01 -1.08E+00
Head and neck cancer 2D42 Head and neck tissue 5.79E-05 -2.71E-01 -2.12E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.18E-01 -1.91E-01 -8.97E-01
Huntington's disease 8A01.10 Whole blood 9.83E-01 -1.88E-02 -8.22E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.16E-01 4.27E-02 2.28E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.28E-01 1.50E-02 1.21E-01
Influenza 1E30 Whole blood 3.27E-04 7.58E-01 4.79E+00
Interstitial cystitis GC00.3 Bladder tissue 5.41E-01 -1.07E-02 -1.16E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.78E-01 1.98E-02 9.99E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.80E-01 -8.44E-02 -3.04E-01
Ischemic stroke 8B11 Peripheral blood 3.65E-01 5.56E-02 4.25E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.26E-02 1.28E-01 3.83E-01
Lateral sclerosis 8B60.4 Skin 7.72E-01 -3.81E-02 -1.70E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.74E-01 -8.19E-02 -2.64E-01
Liver cancer 2C12.0 Liver tissue 2.01E-01 -8.61E-02 -3.29E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.01E-02 1.37E-01 5.98E-01
Lung cancer 2C25 Lung tissue 4.06E-17 -4.88E-01 -1.11E+00
Lupus erythematosus 4A40 Whole blood 1.39E-02 -6.81E-02 -1.61E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.69E-01 -4.23E-04 -2.31E-03
Major depressive disorder 6A70-6A7Z Whole blood 4.13E-01 1.58E-02 5.64E-02
Melanoma 2C30 Skin 7.21E-03 -1.97E+00 -1.10E+00
Multiple myeloma 2A83.1 Peripheral blood 7.28E-01 3.96E-02 1.73E-01
Multiple myeloma 2A83.1 Bone marrow 3.85E-01 4.35E-02 2.11E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.04E-01 1.23E-01 5.16E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.51E-02 -3.08E-02 -1.46E-01
Myelofibrosis 2A20.2 Whole blood 1.23E-02 2.19E-01 1.22E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.57E-03 1.05E-01 4.37E-01
Myopathy 8C70.6 Muscle tissue 1.12E-01 -2.02E-01 -1.20E+00
Neonatal sepsis KA60 Whole blood 1.73E-01 6.09E-02 2.18E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.68E-03 -5.17E-01 -1.45E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.43E-01 -5.78E-02 -4.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.77E-01 -8.16E-02 -7.32E-01
Olive pollen allergy CA08.00 Peripheral blood 4.37E-01 -5.15E-02 -1.81E+00
Oral cancer 2B6E Oral tissue 7.60E-05 -1.31E+00 -9.72E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.55E-01 -1.97E-01 -5.27E-01
Osteoporosis FB83.1 Bone marrow 4.18E-01 2.10E-02 1.77E-01
Ovarian cancer 2C73 Ovarian tissue 3.39E-03 2.04E-01 7.75E-01
Pancreatic cancer 2C10 Pancreas 4.24E-01 -1.03E-02 -2.27E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 9.14E-01 -9.71E-02 -2.38E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.99E-01 -1.10E-01 -6.67E-01
Pituitary cancer 2D12 Pituitary tissue 3.35E-02 3.89E-01 1.34E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.37E-01 2.85E-01 1.02E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.88E-01 -3.83E-02 -2.84E-01
Polycythemia vera 2A20.4 Whole blood 6.92E-05 1.14E-01 6.44E-01
Pompe disease 5C51.3 Biceps muscle 8.55E-02 -8.72E-02 -5.96E-01
Preterm birth KA21.4Z Myometrium 4.61E-01 1.90E-01 7.10E-01
Prostate cancer 2C82 Prostate 5.29E-02 -6.45E-01 -7.25E-01
Psoriasis EA90 Skin 1.72E-24 1.00E+00 1.55E+00
Rectal cancer 2B92 Rectal colon tissue 3.60E-03 9.19E-01 2.07E+00
Renal cancer 2C90-2C91 Kidney 2.51E-05 -9.75E-01 -2.67E+00
Retinoblastoma 2D02.2 Uvea 7.21E-04 -1.67E-01 -8.31E-01
Rheumatoid arthritis FA20 Synovial tissue 3.05E-06 -1.05E+00 -5.26E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.58E-01 -4.37E-02 -1.31E-01
Schizophrenia 6A20 Prefrontal cortex 9.69E-01 3.48E-03 1.02E-02
Schizophrenia 6A20 Superior temporal cortex 8.40E-01 6.15E-02 3.66E-01
Scleroderma 4A42.Z Whole blood 4.32E-02 1.43E-01 1.14E+00
Seizure 8A60-8A6Z Whole blood 1.95E-01 -1.83E-01 -1.04E+00
Sensitive skin EK0Z Skin 6.62E-01 2.97E-02 6.89E-02
Sepsis with septic shock 1G41 Whole blood 6.20E-02 4.24E-02 1.51E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.86E-03 -2.31E-01 -2.78E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.16E-01 -9.98E-02 -2.94E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.79E-01 1.50E-01 8.33E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.31E-01 -1.39E-01 -5.29E-01
Skin cancer 2C30-2C3Z Skin 3.97E-82 -2.77E+00 -4.30E+00
Thrombocythemia 3B63 Whole blood 9.49E-02 1.95E-01 1.13E+00
Thrombocytopenia 3B64 Whole blood 4.05E-01 1.81E-01 5.04E-01
Thyroid cancer 2D10 Thyroid 1.31E-09 1.54E-01 5.93E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.20E-04 -3.23E-01 -1.55E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.07E-01 1.55E-01 6.71E-01
Type 2 diabetes 5A11 Liver tissue 2.00E-01 -1.12E-01 -6.69E-01
Ureter cancer 2C92 Urothelium 8.92E-01 -6.68E-03 -4.04E-02
Uterine cancer 2C78 Endometrium tissue 1.51E-01 4.59E-01 3.53E-01
Vitiligo ED63.0 Skin 9.83E-01 -3.33E-02 -1.46E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b). J Steroid Biochem Mol Biol. 2001 Jun;77(4-5):261-9.