Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT03L8AN)
| DOT Name | Barrier-to-autointegration factor-like protein (BANF2) | ||||
|---|---|---|---|---|---|
| Synonyms | BAF-L; Barrier-to-autointegration factor 2 | ||||
| Gene Name | BANF2 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MDNMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEF
QRWLICCFGATECEAQQTSHCLKEWCACFL |
||||
| Function | May play a role in BANF1 regulation and influence tissue-specific roles of BANF1. | ||||
| Tissue Specificity | Expressed strongly in testis and pancreas. Also detected in brain, colon, liver, lung, ovary, placenta, prostate, small intestine, spleen and thymus. Not detected in heart, kidney and skeletal muscle. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||
References
